kernel-16k-modules-partner-6.14.8-400.asahi.el9@>0     3!Iͩ\d:÷(Uފ<hQleif.linux@gmail.com Uފ< U(c7%XESPjC3%~8!UfKMTz^[366a1f93d89a91c9a4ccb459794b295b4a1741e74d8b57865366e89f2cd81a898cd8410578f90722692a576ed34e63d189697da0 1u?Y£a xd]g]=H>>?d$ 2 [ 06>oc,c "c +c =Dc Bgc FcXXcnGc6\c 0 T  (8H9H:2H>K@SG\cHcI"tcX& Y' \'c]9Dc^WbcdefltcuDcvw4cxcyL\`fCkernel-16k-modules-partner6.14.8400.asahi.el9Extra kernel modules to match the kernelThis package provides kernel modules for the kernel package for Red Hat partners usage.hQrpm_builder((GPL-2.0-only WITH Linux-syscall-note) OR BSD-2-Clause) AND ((GPL-2.0-only WITH Linux-syscall-note) OR BSD-3-Clause) AND ((GPL-2.0-only WITH Linux-syscall-note) OR CDDL-1.0) AND ((GPL-2.0-only WITH Linux-syscall-note) OR Linux-OpenIB) AND ((GPL-2.0-only WITH Linux-syscall-note) OR MIT) AND ((GPL-2.0-or-later WITH Linux-syscall-note) OR BSD-3-Clause) AND ((GPL-2.0-or-later WITH Linux-syscall-note) OR MIT) AND 0BSD AND BSD-2-Clause AND (BSD-2-Clause OR Apache-2.0) AND BSD-3-Clause AND BSD-3-Clause-Clear AND CC0-1.0 AND GFDL-1.1-no-invariants-or-later AND GPL-1.0-or-later AND (GPL-1.0-or-later OR BSD-3-Clause) AND (GPL-1.0-or-later WITH Linux-syscall-note) AND GPL-2.0-only AND (GPL-2.0-only OR Apache-2.0) AND (GPL-2.0-only OR BSD-2-Clause) AND (GPL-2.0-only OR BSD-3-Clause) AND (GPL-2.0-only OR CDDL-1.0) AND (GPL-2.0-only OR GFDL-1.1-no-invariants-or-later) AND (GPL-2.0-only OR GFDL-1.2-no-invariants-only) AND (GPL-2.0-only WITH Linux-syscall-note) AND GPL-2.0-or-later AND (GPL-2.0-or-later OR BSD-2-Clause) AND (GPL-2.0-or-later OR BSD-3-Clause) AND (GPL-2.0-or-later OR CC-BY-4.0) AND (GPL-2.0-or-later WITH GCC-exception-2.0) AND (GPL-2.0-or-later WITH Linux-syscall-note) AND ISC AND LGPL-2.0-or-later AND (LGPL-2.0-or-later OR BSD-2-Clause) AND (LGPL-2.0-or-later WITH Linux-syscall-note) AND LGPL-2.1-only AND (LGPL-2.1-only OR BSD-2-Clause) AND (LGPL-2.1-only WITH Linux-syscall-note) AND LGPL-2.1-or-later AND (LGPL-2.1-or-later WITH Linux-syscall-note) AND (Linux-OpenIB OR GPL-2.0-only) AND (Linux-OpenIB OR GPL-2.0-only OR BSD-2-Clause) AND Linux-man-pages-copyleft AND MIT AND (MIT OR Apache-2.0) AND (MIT OR GPL-2.0-only) AND (MIT OR GPL-2.0-or-later) AND (MIT OR LGPL-2.1-only) AND (MPL-1.1 OR GPL-2.0-only) AND (X11 OR GPL-2.0-only) AND (X11 OR GPL-2.0-or-later) AND Zlib AND (copyleft-next-0.3.1 OR GPL-2.0-or-later)System Environment/Kernelhttps://www.kernel.org/linuxaarch64/sbin/depmod -a 6.14.8-400.asahi.el9.aarch64+16k/sbin/depmod -a 6.14.8-400.asahi.el9.aarch64+16krPLAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA큤hQhQhQhQ{hQ{hQ{hQ{hQhQhQ{hQhQ{hQ{hQzhQ{hQ{hQ{hQhQ{hQhQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQhQ{hQhQ{hQhQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQhQ{hQ{hQ{hQ{hQhQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQhQhQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQhQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQhQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQ{hQhQ{hQhQ{hQ{hQhQhQ{hQhQ{hQ{hQ{hQ{hQhQ~hQ{hQhQɃhQɃhQɃhQɃhQhQɃhQɃhQ{hQɃhQɃhQɃhQ{hQ{hQ{hQ{hQ{hQhQ{hQ{hQ{hQ{hQhQ{hQ{hQ|hQ|hQ{hQ|hQ|hQ~hQ~hQ{hQ|hQ|hQ|hQ|hQhQ|hQ}hQ{hQ{hQ{hQ|hQhQ|hQ|hQ|hQ|hQ|hQ|hQ{hQ|hQ|hQ|hQ~hQ~hQ~hQ|hQ~hQ|hQ|hQ|hQ|hQ|hQ}hQ|hQ}hQhQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQhQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQ}hQhQ}hQhQ~hQhQ~hQ~hQ~hQ~hQ~hQ~hQ~hQ~hQ~hQ}hQhQ}hQ}hQhQ}hQ}hQ}hQ}hQ~hQ~hQ~hQ~hQ}hQ~hQ}hQ}hQ~hQ~hQ}hQ~hQhQ~hQhQ~hQ~hQ~hQhQhQ~hQ~hQ~hQ~hQ~hQ~hQ~hQ~hQ~hQ~hQ~hQhQhQ~hQ~hQhQ~hQ~hQ~hQ~hQhQ~hQ~hQ~hQ~hQ~hQ~hQ~hQ~hQ~hQhQ~hQhQ~hQ~hQ~hQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQhQɀhQhQhQhQɀhQɀhQhQhQhQhQhQhQhQhQɀhQhQhQhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQhQhQɀhQɀhQɀhQɀhQhQhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɃhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɀhQɁhQɀhQɀhQɀhQɀhQɀhQhQɀhQɁhQɀhQɀhQhQɁhQɁhQhQɁhQɁhQɀhQhQɀhQɀhQɀhQɀhQɂhQɁhQɂhQɂhQɂhQhQɂhQɀhQhQɀhQɀhQɁhQɁhQhQɁhQɁhQɁhQɁhQhQɁhQɁhQɀhQɁhQɁhQɀhQɀhQhQɀhQɀhQhQɀhQɀhQɀhQɀhQɀhQɃhQɁhQɁhQɁhQɁhQɁhQɂhQɂhQɃhQɃhQɃhQɃhQɃhQɃhQɃhQɃhQɁhQɃhQɄhQɄhQhQɀhQɁhQɁhQhQɁhQhQɂhQɀhQɀhQɁhQɁhQɁhQɁhQhQɁhQhQɁhQɁhQɁhQhQɂhQɁhQɁhQhQɁhQɂhQɁhQɂhQɂhQɂhQhQɂhQɂhQɂhQɂhQɂhQhQɁhQɁhQɁhQɁhQhQɁhQɁhQɁhQɁhQɁhQɁhQhQɁhQɁhQɁhQɁhQɁhQɁhQɁhQɂhQɂhQɁhQɁhQhQɁhQɂhQɁhQɁhQɁhQɁhQɁhQɂhQɂhQɂhQɂhQɂhQɂhQɂhQɂhQhQɃhQɂhQɂhQɂhQɂhQɂhQɂhQɃhQɃhQɃhQɃhQhQɂhQɃhQhQɃhQɃhQɃhQɃhQɃhQɃhQhQɄhQɄhQɄhQɄhQhQhQɂhQɄhQɂhQhQɃhQɂhQɂhQɂhQɂhQɂhQɂhQɃhQɃhQɂhQhQɃhQhQɃhQhQhQɂhQɂhQɃhQɃhQɃhQɃhQɃhQɃhQɃhQɃhQɃhQɃhQɃhQɃhQɃhQɂhQɃhQɃhQɄhQɃhQhQɃhQhQɃhQɃhQɃhQɃhQɃhQhQɃhQɃhQɃhQɃhQɃhQɃhQɃhQɃhQɃhQɃhQɃhQhQɃhQɃhQɃhQɃhQɃhQhQɃhQɃhQɃhQɃhQɃhQɃhQɄhQɃhQɃhQɄhQɄhQɃhQɃhQɄhQɄhQɃhQɃhQɄhQɄhQɄhQɄhQɄhQɄhQɄhQɄhQɄhQhQɄhQɄhQɄhQɄhQɄhQɄhQhQɄhQɄhQɄhQɄhQhQɄhQɄhQɄhQɄhQhQɄhQɄhQɄhQɄhQɄhQɄhQɄhQɄhQɄhQɄhQɄhQɄhQɄhQɄhQɇhQɄhQɄhQɄhQɄhQɄhQɄhQɄhQɄhQɄhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɆhQɆhQɆhQɆhQɆhQɆhQɆhQɇhQɇhQɄhQhQɄhQɄhQɅhQɅhQɅhQɅhQɅhQɄhQɄhQɄhQɅhQɅhQɅhQhQhQɅhQhQɅhQɅhQhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɆhQɆhQɆhQɆhQɆhQɆhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQhQɅhQɅhQɅhQhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQɅhQhQɅhQhQɅhQɅhQɅhQɅhQɆhQɅhQɅhQɅhQɆhQɉhQɆhQhQɇhQɇhQɇhQɈhQɈhQɈhQɈhQhQɈhQɈhQɆhQɆhQɆhQɆhQɆhQɆhQɆhQɆhQɆhQɆhQɆhQɆhQɆhQɅhQɆhQɆhQɇhQɇhQɆhQɆhQɆhQɆhQɆhQhQɇhQɇhQɇhQɇhQɇhQɇhQɇhQɉhQɉhQɊhQhQɉhQhQhQhQɉhQɆhQɊhQhQɆhQɆhQhQɆhQɆhQhQhQɆhQɆhQɆhQɆhQɆhQɆhQɆhQɆhQɇhQɆhQɆhQɆhQɆhQɇhQɆhQɆhQɇhQɇhQɇhQɇhQhQɆhQɆhQɆhQɆhQɇhQɇhQɇhQɇhQɇhQɇhQɇhQɇhQɇhQɈhQhQɈhQɈhQhQɇhQɈhQɇhQɇhQɇhQɇhQɇhQɇhQɇhQɇhQɇhQɇhQɇhQhQɇhQɈhQɈhQɈhQɈhQɈhQɉhQɉhQɇhQɈhQhQɈhQɈhQɊhQɈhQɈhQɈhQɈhQɈhQɇhQɈhQɈhQɈhQɈhQɇhQɇhQɉhQɇhQɈhQɈhQɈhQɈhQɈhQɈhQɈhQɈhQɈhQɈhQɈhQɈhQɈhQɈhQɈhQɈhQɈhQɈhQɈhQɈhQɉhQɈhQɈhQɈhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɉhQɊhQhQzhQz32d93fc03e020da7ad7ed65628d8b467958ae79634ede48f8baac2381ed01a2212af0a9902894be6678ad65d1c3e2211160d59249cb513c31b35f5bfe8d3585a00dc2f34c74d40532718ac7ab62a020496b0b27d62fed3c72d28993350d265e9rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootkernel-6.14.8-400.asahi.el9.src.rpmconfig(kernel-16k-modules-partner)installonlypkg(kernel-module)kernel-16k-modules-partnerkernel-16k-modules-partnerkernel-16k-modules-partner(aarch-64)kernel-16k-modules-partner-aarch64kernel-16k-modules-partner-aarch64kernel-16k-modules-partner-uname-rkmod(kafs.ko)kmod(rxrpc.ko)modalias(fs-afs)modalias(net-pf-33)    /bin/sh/bin/shkernel-16k-modules-core-uname-rkernel-16k-modules-uname-rkernel-uname-rrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)6.14.8-400.asahi.el9.aarch64++16k6.14.8-400.asahi.el9.aarch64++16k6.14.8-400.asahi.el9.aarch64++16k3.0.4-14.6.0-14.0-15.2-14.16.1.3h9h/h)h@hh y@hgg@gI@gI@ggަ@gTg@gڱg`@ggֽ@gkg@ggw@g%g@g1@ggɎ@g [6.14.8-400.asahi]Augusto Caringi [6.14.8-0]Justin M. Forbes [6.14.7-0]Augusto Caringi [6.14.6-0]Justin M. Forbes [6.14.5-0]Justin M. Forbes [6.14.4-0]Justin M. Forbes [6.14.3-0]Justin M. Forbes [6.14.2-0]Justin M. Forbes [6.14.1-0]Justin M. Forbes [6.14.0-1]Fedora Kernel Team [6.14.0-62]Fedora Kernel Team [6.14.0-0.rc7.586de92313fc.61]Fedora Kernel Team [6.14.0-0.rc7.88d324e69ea9.60]Fedora Kernel Team [6.14.0-0.rc7.b3ee1e460951.59]Fedora Kernel Team [6.14.0-0.rc7.a7f2e10ecd8f.58]Fedora Kernel Team [6.14.0-0.rc7.81e4f8d68c66.57]Fedora Kernel Team [6.14.0-0.rc7.76b6905c11fd.56]Fedora Kernel Team [6.14.0-0.rc7.55]Fedora Kernel Team [6.14.0-0.rc6.cb82ca153949.54]Fedora Kernel Team [6.14.0-0.rc6.3571e8b091f4.53]Fedora Kernel Team [6.14.0-0.rc6.695caca9345a.52]Fedora Kernel Team [6.14.0-0.rc6.b7f94fcf5546.51]Fedora Kernel Team [6.14.0-0.rc6.0fed89a961ea.50]Fedora Kernel Team [6.14.0-0.rc6.4d872d51bc9d.49]Fedora Kernel Team [6.14.0-0.rc6.48]Fedora Kernel Team [6.14.0-0.rc5.2a520073e74f.47]Fedora Kernel Team [6.14.0-0.rc5.00a7d39898c8.46]Fedora Kernel Team [6.14.0-0.rc5.848e07631744.45]Fedora Kernel Team [6.14.0-0.rc5.48a5eed9ad58.44]Fedora Kernel Team [6.14.0-0.rc5.99fa936e8e4f.43]Fedora Kernel Team [6.14.0-0.rc5.42]Fedora Kernel Team [6.14.0-0.rc4.ece144f151ac.41]Fedora Kernel Team [6.14.0-0.rc4.03d38806a902.40]Fedora Kernel Team [6.14.0-0.rc4.76544811c850.39]Fedora Kernel Team [6.14.0-0.rc4.dd83757f6e68.38]Fedora Kernel Team [6.14.0-0.rc4.ac9c34d1e45a.37]Fedora Kernel Team [6.14.0-0.rc4.36]Fedora Kernel Team [6.14.0-0.rc4.35]Fedora Kernel Team [6.14.0-0.rc3.27102b38b8ca.34]Fedora Kernel Team [6.14.0-0.rc3.ff202c5028a1.33]Fedora Kernel Team [6.14.0-0.rc3.334426094588.32]Fedora Kernel Team [6.14.0-0.rc3.87a132e73910.31]Fedora Kernel Team [6.14.0-0.rc3.6537cfb395f3.30]Fedora Kernel Team [6.14.0-0.rc3.2408a807bfc3.29]Fedora Kernel Team [6.14.0-0.rc3.28]Fedora Kernel Team [6.14.0-0.rc2.ad1b832bf1cf.27]Fedora Kernel Team [6.14.0-0.rc2.7ff71e6d9239.26]Fedora Kernel Team [6.14.0-0.rc2.128c8f96eb86.25]Fedora Kernel Team [6.14.0-0.rc2.4dc1d1bec898.24]Fedora Kernel Team [6.14.0-0.rc2.09fbf3d50205.23]Fedora Kernel Team [6.14.0-0.rc2.febbc555cf0f.22]Fedora Kernel Team [6.14.0-0.rc2.21]Fedora Kernel Team [6.14.0-0.rc1.9946eaf552b1.20]Fedora Kernel Team [6.14.0-0.rc1.8f6629c004b1.19]Fedora Kernel Team [6.14.0-0.rc1.bb066fe812d6.18]Fedora Kernel Team [6.14.0-0.rc1.92514ef226f5.17]Fedora Kernel Team [6.14.0-0.rc1.5c8c229261f1.16]Fedora Kernel Team [6.14.0-0.rc1.0de63bb7d919.15]Fedora Kernel Team [6.14.0-0.rc1.14]Fedora Kernel Team [6.14.0-0.rc0.a86bf2283d2c.13]Fedora Kernel Team [6.14.0-0.rc0.60c828cf80c0.12]Fedora Kernel Team [6.14.0-0.rc0.69e858e0b8b2.11]Fedora Kernel Team [6.14.0-0.rc0.72deda0abee6.10]Fedora Kernel Team [6.14.0-0.rc0.05dbaf8dd8bf.9]Fedora Kernel Team [6.14.0-0.rc0.6d61a53dd6f5.8]Fedora Kernel Team [6.14.0-0.rc0.9c5968db9e62.7]Fedora Kernel Team [6.14.0-0.rc0.aa22f4da2a46.6]Fedora Kernel Team [6.14.0-0.rc0.aa22f4da2a46.5]Fedora Kernel Team [6.14.0-0.rc0.bc8198dc7ebc.4]Fedora Kernel Team [6.14.0-0.rc0.d0d106a2bd21.3]Fedora Kernel Team [6.14.0-0.rc0.c4b9570cfb63.2]Fedora Kernel Team [6.14.0-0.rc0.95ec54a420b8.62]- redhat: Conditionally disable libbpf_dynamic on for KVVec (Janne Grunau) - drm: asahi: starlight-debug (Sasha Finkelstein) - DO NOT SUBMIT: arm64: dts: apple: t8103-j457: Add unused PCIe port01 (Janne Grunau) - Revert "HACK: Lol libwebrtc" (Janne Grunau) - rust: alloc: drain: Fix build with rust 1.87 (Janne Grunau) - rust: iio: common: aop: Add TODO fn/struct docs (Janne Grunau) - ASoC: apple: aop: Add module parameter to check mics without beamforming (Janne Grunau) - soc: apple: Add SEP driver. (Sasha Finkelstein) - rust: soc: apple: Add Apple mailbox abstractions (Sasha Finkelstein) - iio: common: Add AOP sensor drivers. (Sasha Finkelstein) - ASoC: apple: Add aop_audio driver. (Sasha Finkelstein) - soc: apple: Add support for the AOP co-processor. (Sasha Finkelstein) - rust: WIP(?): Various bits of rust glue for AOP series (Sasha Finkelstein) - rust: soc: apple: rtkit: Add apple_rtkit_has_endpoint (Sasha Finkelstein) - rust: bindgen: Make snd_dec_flac opaque (Janne Grunau) - rust: bindings: Add (Janne Grunau) - fixup! media: apple: Add Apple ISP driver (Janne Grunau) - media: apple: isp: Support system sleep (Eileen Yoon) - media: apple: isp: Use a mutex instead of a spinlock for channels (Hector Martin) - media: apple: isp: implement ENUM_FRAMEINTERVALS trivially (Hector Martin) - media: apple: isp: Enable IMX364 sensor (Hector Martin) - media: apple: isp: Show camera presets even for unsupported sensors (Hector Martin) - media: apple: isp: Parse firmware version from device tree (Janne Grunau) - media: apple: isp: Use a more user-friendly device name (Hector Martin) - media: apple: isp: Option to use CMD_STOP (ifdeffed out) (Asahi Lina) - media: apple: isp: Only reset coproc when necessary, fix minor race (Asahi Lina) - media: apple: isp: VMap only what is necessary, remove redundant logging state bit (Asahi Lina) - media: apple: isp: Add a missing read barrier (possibly?) (Asahi Lina) - media: apple: isp: Clear IRQs when resetting coproc (Asahi Lina) - media: apple: isp: Rework meta surface handling & buffer return (Asahi Lina) - media: apple: isp: Use cached IOMMU mappings (Asahi Lina) - media: apple: isp: Zero out pages allocated to ISP (Asahi Lina) - media: apple: isp: Make sub-pmdomain handling explicit (Asahi Lina) - media: apple: isp: Minor changes to cam flow (Asahi Lina) - media: apple: isp: Add flicker_sensor_set cmd (Asahi Lina) - media: apple: isp: t8112 fixes... (Asahi Lina) - media: apple: isp: Limit maximal number of buffers (Janne Grunau) - media: apple: isp: t8112 HW config (Janne Grunau) - media: apple: isp: Use a second region for MBOX_IRQ_{DOORBELL,ACK} (Janne Grunau) - media: apple: isp: Make channel sends not interruptible (Asahi Lina) - media: apple: isp: Maybe fix some DMA ordering issues (Asahi Lina) - media: apple: isp: Add STOP and POWER_DOWN commands (Asahi Lina) - media: apple: isp: Implement posted commands (Asahi Lina) - media: apple: isp: Propagate EINTR from firmware loads (Asahi Lina) - media: apple: isp: Remove ioread/iowrite and stop doing raw address translation (Asahi Lina) - media: apple: isp: Switch to threaded IRQs (Asahi Lina) - media: apple: isp: Always enable singleplane API, make multiple a module param (Asahi Lina) - media: apple: isp: Working t602x and multiple formats and more fixes (Asahi Lina) - media: apple: isp: t602x hw config (Asahi Lina) - media: apple: isp: Support >32bit VAs for t602x (Asahi Lina) - media: apple: isp: fix copyright (Eileen Yoon) - media: apple: isp: alloc static surfaces only once (Eileen Yoon) - media: apple: isp: misc isp-fw.c improvements (Eileen Yoon) - media: apple: isp: rm old isp_resv struct (Eileen Yoon) - media: apple: isp: rm unused bootargs members (Eileen Yoon) - media: apple: isp: s/asc/coproc/ (Eileen Yoon) - media: apple: isp: wmb() before GPIO write (Eileen Yoon) - media: apple: isp: Don't use define for bootargs size (Eileen Yoon) - media: apple: isp: Better document info struct fields (Eileen Yoon) - media: apple: isp: Set platform_id in bootargs (Eileen Yoon) - media: apple: WIP: t6000 hax (Hector Martin) - media: apple: isp: Do not defer on failure to initialize DART (Hector Martin) - media: apple: isp: Drop the DART mirroring stuff (Hector Martin) - media: apple: isp: Split gpio/mbox MMIO range (Eileen Yoon) - media: apple: isp: Enable t6000 (Hector Martin) - media: apple: isp: Fixup shared region arg (Hector Martin) - media: apple: isp: Use preallocated heap (Hector Martin) - media: apple: isp: IMX558 initial support (Eileen Yoon) - media: apple: Add Apple ISP driver (Eileen Yoon) - drm: adp: Remove pointless irq_lock spin lock (Janne Grunau) - drm: adp: Enable vblank interrupts in crtc's .atomic_enable (Janne Grunau) - drm: adp: Handle drm_crtc_vblank_get() errors (Janne Grunau) - drm: adp: Use spin_lock_irqsave for drm device event_lock (Janne Grunau) - fixup! drm: adp: Add Apple Display Pipe driver (Janne Grunau) - MAINTAINERS: Add entries for Apple Z2 touchscreen driver (Sasha Finkelstein) - input: apple_z2: Add a driver for Apple Z2 touchscreens (Sasha Finkelstein) - dt-bindings: input: touchscreen: Add Z2 controller (Sasha Finkelstein) - drm: adp: Fix NULL vs IS_ERR() check in adp_plane_new() (Dan Carpenter) - MAINTAINERS: Add entries for touchbar display driver (Sasha Finkelstein) - drm: panel: Add a panel driver for the Summit display (Sasha Finkelstein) - drm: adp: Add Apple Display Pipe driver (Sasha Finkelstein) - dt-bindings: display: Add Apple pre-DCP display controller (Sasha Finkelstein) - arm64: cpufeature: Unify SCOPE_LOCAL_CPU early & late behavior (Asahi Lina) - KVM: arm64: Expose TSO capability to guests and context switch (Asahi Lina) - arm64: Implement Apple IMPDEF TSO memory model control (Hector Martin) - arm64: Introduce scaffolding to add ACTLR_EL1 to thread state (Hector Martin) - arm64: Implement PR_{GET,SET}_MEM_MODEL for always-TSO CPUs (Hector Martin) - prctl: Introduce PR_{SET,GET}_MEM_MODEL (Hector Martin) - drm/asahi: Update uapi/drm/asahi_drm.h to new UAPI (Alyssa Rosenzweig) - drm/asahi: port to new UAPI (Alyssa Rosenzweig) - rust: time: bind NSECS_PER_SEC (Alyssa Rosenzweig) - drm/asahi: crashdump: Clippy fixes (Asahi Lina) - drm/asahi: Hook up crashdump to devcoredump (Asahi Lina) - rust: devcoredump: Add devcoredump abstraction (Asahi Lina) - rust: uapi: Add ELF headers (Asahi Lina) - drm/asahi: use only a single run queue for drm-sched (Janne Grunau) - drm/asahi: Depend on DRM=y (Janne Grunau) - drm/asahi: workqueue: Access AsahiData via pdev.drvdata (Janne Grunau) - drm/asahi: queue: Access AsahiData via pdev.drvdata (Janne Grunau) - drm/asahi: mmu: Access AsahiData via pdev.drvdata (Janne Grunau) - drm/asahi: gpu: Access AsahiData via pdev.drvdata (Janne Grunau) - drm/asahi: Add AsahiData to the platform device drvdata (Janne Grunau) - drm/asahi: file: adapt to new DRM file/ioctl rust abstractions (Janne Grunau) - drm/asahi: driver: Port to dma_set_mask_and_coherent() from ml (Janne Grunau) - drm/asahi: regs: Update to upstream-ish io::IoMem (Janne Grunau) - drm/asahi: Adapt robust_isolation module parameter (Janne Grunau) - drm/asahi: Adapt initial_tvb_size module parameter (Janne Grunau) - drm/asahi: Adapt fault_control module parameter (Janne Grunau) - drm/asahi: Adapt debug_flags module parameter (Janne Grunau) - drm/asahi: Port to kernel::uaccess (Janne Grunau) - drm/asahi: pgtable: Fix missing nonglobal bit (Asahi Lina) - drm/asahi: regs: Clippy fixes (Asahi Lina) - drm/asahi: render: Clippy fixes (Asahi Lina) - drm/asahi: Get rid of util::div_ceil() (Asahi Lina) - drm/asahi: queue::compute: Clippy fixes (Asahi Lina) - drm/asahi: pgtable: Clippy fixes (Asahi Lina) - drm/asahi: object: Clippy fixes (Asahi Lina) - drm/asahi: microseq: Clippy fixes (Asahi Lina) - drm/asahi: mmu: Clippy fixes (Asahi Lina) - drm/asahi: mem: Clippy fixes (Asahi Lina) - drm/asahi: fw: Clippy fixes (Asahi Lina) - drm/asahi: float: Clippy fixes (Asahi Lina) - drm/asahi: File: Clippy fixes (Asahi Lina) - drm/asahi: event: Clippy fixes (Asahi Lina) - drm/asahi: channel: Clippy fixes (Asahi Lina) - drm/asahi: buffer: Clippy fixes (Asahi Lina) - drm/asahi: alloc: Clippy fixes (Asahi Lina) - drm/asahi: mmu: Use abstractions, drop bindings import (Asahi Lina) - drm/asahi: pgtable: Mark GPU entries as uncached (Asahi Lina) - drm/asahi: mmu: Preallocate page tables before sm_map() (Asahi Lina) - drm/asahi: gpu: Hook up crashdump generation (Asahi Lina) - drm/asahi: mmu: Wire up kernel AS dumper (Asahi Lina) - drm/asahi: crashdump: Add crash dumper module (Asahi Lina) - drm/asahi: pgtable: Add helpers for decoding PTE perms (Asahi Lina) - drm/asahi: pgtable: Add dumper (Asahi Lina) - drm/asahi: Depend on PAGE_SIZE_16KB (Asahi Lina) - drm/asahi: Implement ASAHI_BIND_SINGLE_PAGE (Asahi Lina) - drm/asahi: RiiR page tables (Asahi Lina) - drm/asahi: mmu: Add some barriers (Asahi Lina) - drm/asahi: debug: Add PgTable debug category (Asahi Lina) - drm: asahi: mmu: UAT change for rust page table rewrite (Asahi Lina) - drm/asahi: mmu: Change step_remap() to new api (Asahi Lina) - drm/asahi: mmu: Fix deadlock on remap ops (Asahi Lina) - drm/asahi: workqueue: Defer freeing the last completed work item (Asahi Lina) - drm/asahi: Update crashed() RTKit API (Asahi Lina) - drm/asahi: mmu: Fix 2x step_remap case (Asahi Lina) - drm/asahi: file: Reject gem_bind past the end of the object (Asahi Lina) - drm/asahi: mmu: Change step_remap() to new api (Asahi Lina) - drm/asahi: Map all reserved-regions as cached (Asahi Lina) - drm/asahi: Add the USER_TIMESTAMPS feature (Asahi Lina) - drm/asahi: Set a bit for internal non-render barriers on G14X (Asahi Lina) - drm/asahi: file: Add user_timestamp_frequency_hz to params (Asahi Lina) - drm/asahi: queue/render,compute: Plumb through timestamps extension (Asahi Lina) - drm/asahi: queue/render,compute: Handle cmdbuf size mismatches (Asahi Lina) - drm/asahi: fw, queue: Plumb through UserTimestamps -> TimestampPointers (Asahi Lina) - drm/asahi: queue: Plumb through objects XArray and add timestamp getter (Asahi Lina) - drm/asahi: fw, queue: Add UserTimestamp object to job structs (Asahi Lina) - drm/asahi: file: Implement ASAHI_GEM_BIND_OBJECT (Asahi Lina) - drm/asahi: gpu: Implement mapping timestamp buffers (Asahi Lina) - drm/asahi: util: Commend out unused len() method (Asahi Lina) - drm/asahi: gpu: Remove unused wait_for_poweroff() (Asahi Lina) - drm/asahi: workqueue: Restrict command objects to only job commands (Asahi Lina) - drm/asahi: alloc: Remove unused methods (Asahi Lina) - drm/asahi: Document timestamp ops better, refactor fields (Asahi Lina) - drm/asahi: gpu: Add a max object count garbage limit (Asahi Lina) - drm/asahi: alloc: Be more verbose about failures (Asahi Lina) - drm/asahi: gpu: Collect garbage for private/gpuro together (Asahi Lina) - drm/asahi: driver: Port to new device/driver registration (Janne Grunau) - drm/asahi: regs: Get device ref from platform dev (Janne Grunau) - drm/asahi: mmu: Move closer to rust of integration (Janne Grunau) - drm/asahi: gpu: Get resources directly through DRM pricate data (Janne Grunau) - drm/asahi: gpu: Force Box move with manual Box::into_inner() (Janne Grunau) - drm/asahi: Modify debug dev printk macros to avoid adding ".as_ref()" (Janne Grunau) - drm/asahi: Implement ASAHI_GET_TIME (Asahi Lina) - drm/asahi: Implement missing ASAHI_BIND_OP_UNBIND (Asahi Lina) - drm/asahi: Align kernel range to buffer::PAGE_SIZE (Asahi Lina) - drm/asahi: HACK: Disable compute preemption for now (Asahi Lina) - drm/asahi: Add robust_isolation kernel parameter (Asahi Lina) - drm/asahi: Clean up jobs in a workqueue (Asahi Lina) - drm/asahi: workqueue: Fix "Cannot submit, but queue is empty?" bug (Asahi Lina) - drm/asahi: workqueue,queue: More debug (Asahi Lina) - drm/asahi: event: Initialize stamps to different values (Asahi Lina) - drm/asahi: Handle channel errors (Asahi Lina) - drm/asahi: gpu: Show unknown field in timeouts (Asahi Lina) - drm/asahi: Fix event tracking when JobSubmission is dropped (Asahi Lina) - drm/asahi: Workqueue: Add more debug (Asahi Lina) - drm/asahi: Fix u32 mult overflow on large tilebufs/TPCs (Asahi Lina) - drm/asahi: Enable soft faults by default (Asahi Lina) - drm/asahi: Signal soft fault support to userspace (Asahi Lina) - drm/asahi: file: Update to newer VM_BIND API (Asahi Lina) - drm/asahi: workqueue: Tweak some debug logs (Asahi Lina) - drm/asahi: queue: Split into Queue and QueueInner (Asahi Lina) - drm/asahi: Implement GEM objects sharing a single DMA resv (Asahi Lina) - drm/asahi: mmu: Fix lockdep issues with GpuVm (Asahi Lina) - drm/asahi: Convert more ranges to Range<> (Asahi Lina) - drm/asahi: Move the unknown dummy page to the top of the address space (Asahi Lina) - drm/asahi: mmu: Convert to using Range (Asahi Lina) - drm/asahi: util: Add RangeExt helpers for Range (Asahi Lina) - drm/asahi: Refactor address types (Asahi Lina) - drm/asahi: Convert to GPUVM and implement more VM_BIND ops (Asahi Lina) - drm/asahi: Don't lock up when unmapping PTEs fails (Asahi Lina) - drm/asahi: microseq: Fix warnings (Asahi Lina) - drm/asahi: alloc: Do not allocate memory to free memory (Asahi Lina) - drm/asahi: Check command structure sizes (Asahi Lina) - drm/asahi: Identify and implement helper config register (Asahi Lina) - drm/asahi: compute: Allow no preemption flag (Asahi Lina) - drm/asahi: queue: Alocate the NotifierList as shared (Asahi Lina) - drm/asahi: workqueue: Work around ICE in Rust 1.74 (Asahi Lina) - drm/asahi: initdata: New init chain API for rebase (Hector Martin) - drm/asahi: render, buffer: Fix layered rendering on G13X (again) (Asahi Lina) - drm/asahi: render: Fix layered rendering on G14X (Asahi Lina) - drm/asahi: Fix Clippy complaints (Asahi Lina) - drm/asahi: Identify and allocate clustered layering metadata buf (Asahi Lina) - drm/asahi: Identify & add render VS spills flag (Asahi Lina) - drm/asahi: buffer: Complain more loudly about sync requests (Asahi Lina) - drm/asahi: render: Remove sync TVB growth support (Asahi Lina) - drm/asahi: file: Remove sync limit (Asahi Lina) - drm/asahi: Add verbose UAPI error reporting (Asahi Lina) - drm/asahi: queue: Quieten some debugs (Asahi Lina) - drm/asahi: render: Identify and set Z/S strides for layered rendering (Asahi Lina) - drm/asahi: fw,queue: Implement helper programs (Asahi Lina) - drm/asahi: render: Implement bindless samplers (Asahi Lina) - drm/asahi: compute: Implement bindless samplers (Asahi Lina) - drm/asahi: buffer,render: Identify and provide layer meta buf (Asahi Lina) - drm/asahi: workqueue: Tag GPU buf (Asahi Lina) - drm/asahi: render: Tag AuxFB (Asahi Lina) - drm/asahi: queue/compute: Tag preempt buf (Asahi Lina) - drm/asahi: initdata: Tag more arrays (Asahi Lina) - drm/asahi: buffer: Add tags to all the buffers (Asahi Lina) - drm/asahi: alloc: Use tag as the guard marker (Asahi Lina) - drm/asahi: alloc: Support tagging array allocs (Asahi Lina) - drm/asahi: Expose firmware version to userspace (Asahi Lina) - drm/asahi: hw/t602x: Increase meta/preempt sizes for G14D (Asahi Lina) - drm/asahi: gpu,hw: Fix array IOMappings (Asahi Lina) - drm/asahi: initdata: Fudge t3 calculation a bit (Asahi Lina) - drm/asahi: initdata,hw: Identify & set idle_off_standby_timer (Asahi Lina) - drm/asahi: initdata: Fixes for G14D (Asahi Lina) - drm/asahi: Increase recursion limit (Asahi Lina) - drm/asahi: Enable probing for t6022 (Asahi Lina) - drm/asahi: regs: Fix cluster count for G14D (Asahi Lina) - drm/asahi: hw.t602x: Fixes for t6022 (Asahi Lina) - drm/asahi: fw.channels: Add static assertions for message sizes (Asahi Lina) - drm/asahi: slotalloc: Allow initializing empty slots (Asahi Lina) - drm/asahi: initdata: Initialize GpuStatsFrag properly (Asahi Lina) - drm/asahi: render: Correct some values for G14 (Asahi Lina) - drm/asahi: hw/t8112: Make last IOMapping read-only (Asahi Lina) - drm/asahi: hw/t600x: Expand some mappings (Asahi Lina) - drm/asahi: fw/microseq: Document bits of has_attachments (Asahi Lina) - drm/asahi: initdata: Document more stuff (Asahi Lina) - drm/asahi: initdata: Fix 13.5 field position for G13X (Asahi Lina) - drm/asahi: fw/channels: Document more message types a bit (Asahi Lina) - drm/asahi: fw/channels: Identify subpipe(?) and halt_count fields in tvb ack (Asahi Lina) - drm/asahi: initdata: Fix ver_info for G13 V13.5 (Asahi Lina) - drm/asahi: hw: Drop max_dies (Asahi Lina) - drm/asahi: hw,initdata: Initdata fixes for G14S (Asahi Lina) - drm/asahi: render: Implement unknown value UAPI extension (Asahi Lina) - DO NOT MERGE: drm/asahi: Add an experimental UAPI extension (Asahi Lina) - drm/asahi: Add the Asahi driver for Apple AGX GPUs (Asahi Lina) - rust: bindings: Bind the Asahi DRM UAPI (Asahi Lina) - drm/asahi: Add the Asahi driver UAPI (Asahi Lina) - rust: macros: Add versions macro (Asahi Lina) - drm/gpuvm: Plumb through flags into drm_gpuva_init (Asahi Lina) - drm/gpuva: Add DRM_GPUVA_SINGLE_PAGE flag and logic (Asahi Lina) - drm/gpuvm: Plumb through flags into drm_gpuva_op_map (Asahi Lina) - drm/gpuvm: Add a flags argument to drm_gpuvm_sm_map[_*] (Asahi Lina) - rust: drm/gpuvm: Add GpuVaFlags support (Asahi Lina) - rust: drm/gpuvm: Add interruptible flag to exec_lock() (Asahi Lina) - rust: drm/gpuvm: bo_unmap() should take &GpuVmBo, not ARef. (Asahi Lina) - rust: drm/gpuvm: Pass vm_bo explicitly to step_remap() (Asahi Lina) - rust: drm/gpuvm: Take &GpuVmBo for map_and_link_va() (Asahi Lina) - rust: drm: Add GPUVM Manager abstraction (Asahi Lina) - drm/gpuvm: Add drm_gpuvm_bo_unmap() (Asahi Lina) - rust: drm: sched: Use &mut for ArmedJob.fences() (Janne Grunau) - drm/scheduler: Clean up jobs when the scheduler is torn down. (Asahi Lina) - rust: drm: sched: Add GPU scheduler abstraction (Asahi Lina) - drm/scheduler: Fix UAF in drm_sched_fence_get_timeline_name (Asahi Lina) - rust: drm: syncobj: Add DRM Sync Object abstraction (Asahi Lina) - rust: drm: mm: Add DRM MM Range Allocator abstraction (Asahi Lina) - rust: drm: gem: shmem: Add share_dma_resv() function (Asahi Lina) - rust: drm: gem: Add set_exportable() method (Asahi Lina) - drm/gem: Add a flag to control whether objects can be exported (Asahi Lina) - rust: drm: gem: shmem: Add DRM shmem helper abstraction (Asahi Lina) - rust: helpers: Add bindings/wrappers for dma_resv_lock (Asahi Lina) - drm/gem-shmem: Export VM ops functions (Asahi Lina) - drm/shmem-helper: Add lockdep asserts to vmap/vunmap (Asahi Lina) - rust: drm: gem: Add GEM object abstraction (Asahi Lina) - rust: drm: file: Add File abstraction (Asahi Lina) - rust: drm: add DRM driver registration (Danilo Krummrich) - rust: drm: add device abstraction (Danilo Krummrich) - rust: drm: add driver abstractions (Danilo Krummrich) - rust: drm: ioctl: Add DRM ioctl abstraction (Asahi Lina) - rust: dma_fence: Add DMA Fence abstraction (Asahi Lina) - drm/simpledrm: Use panel-dimensions property as alternative to panel (Janne Grunau) - dt-bindings: display: simple-framebuffer: Add panel-dimensions property (Janne Grunau) - drm: apple: Use piodma default iommu domain (Janne Grunau) - fixup! drm/apple: Get rid of the piodma dummy driver (Janne Grunau) - fixup! WIP: drm/apple: Add DCP display driver (Janne Grunau) - drm/apple: fix audioless build (Alyssa Rosenzweig) - drm: apple: dptx: Issue HPD event early on gpio/type-c disconnect (Janne Grunau) - drm: apple: dptx: Configure number of lanes for dptx-phy (Janne Grunau) - drm: apple: HDMI: Check HPD state before enabling the IRQ (Janne Grunau) - drm: apple: dptx: Rework/document get_max_lane_count() (Janne Grunau) - drm: apple: iomfb: Adapt `IOMFB_METHOD` for gcc 15 (Janne Grunau) - drm: apple: audio: Rework audio service handling (Janne Grunau) - drm: apple: afk: Allow replies after service 'teardown' (Janne Grunau) - drm: apple: dptx: Tidy up lane count handling (Janne Grunau) - drm: apple: dptx: Silence DPTX_APCALL_{GET,SET}_DOWN_SPREAD (Janne Grunau) - drm: apple: Handle dcps with "phys" property as dcpext (Janne Grunau) - drm: apple: Support up to 3 DCP instances. (Janne Grunau) - drm: apple: Revert "Use delayed work for debounced oob HPD" (Janne Grunau) - drm: apple: Use delayed work for debounced oob HPD (Janne Grunau) - drm: apple: iomfb: Clear non-visible planes (Janne Grunau) - drm: apple: Use dest rct in offscreen test (Janne Grunau) - drm: apple: refactor apple_plane_atomic_check (Janne Grunau) - drm: apple: make plane zpos immutable (James Calligeros) - drm: apple: warn about broken sw cursor fallback (James Calligeros) - drm: apple: use correct min/max plane scaling factors (James Calligeros) - drm: apple: add support for overlay planes (James Calligeros) - drm: apple: reject plane commit if it will crash DCP (James Calligeros) - drm: apple: constrain swaps to maximum blendable surfaces (James Calligeros) - drm: apple: respect drm_plane_state zpos (James Calligeros) - drm: apple: Add .get_scanout_buffer for drm_panic support (Janne Grunau) - drm: apple: Add CRTC CRC support (Janne Grunau) - drm: apple: audio: Implement runtime PM support (Janne Grunau) - drm: apple: Enable EDID support by default (Janne Grunau) - ALSA: Introduce 'snd_interval_rate_bits' (Martin Povišer) - drm: apple: iomfb: Provide the EDID as connector property (Janne Grunau) - drm: apple: Add dcpav-service-ep (Janne Grunau) - drm: apple: afk: Optionally match against EPICName (Janne Grunau) - Revert "drm: apple: HACK: Do not delete piodma platform device" (Janne Grunau) - drm: apple: iomfb: Align buffer size on unmap/free as well (Janne Grunau) - drm/apple: Fix missing mode init (feel free to squash) (Asahi Lina) - drm: apple: dptxport: get_max_lane_count: Retrieve lane count from phy (Janne Grunau) - drm: apple: dptx: Fix get_drive_settings retcode (Janne Grunau) - drm: apple: Add oob hotplug event (Sven Peter) - drm/apple: audio: Fix hotplug notifications (Asahi Lina) - drm/apple: audio: Defer DMA channel acquisition to device open (Asahi Lina) - drm/apple: audio: Create a device link to the DMA device (Asahi Lina) - drm/apple: Explicitly stop AFK endpoints on shutdown (Asahi Lina) - drm: apple: Override drm_vblank's page flip event handling [HACK] (Janne Grunau) - drm: apple: disable HDMI audio by default (Janne Grunau) - drm: apple: av: Warn only once about failed calls (Janne Grunau) - drm: apple: Reduce log spam about busy command channel (Janne Grunau) - drm: apple: Fix broken MemDescRelay::release_descriptor callback number (Janne Grunau) - drm: apple: Switch back to drm_atomic_helper_commit_tail_rpm() (Janne Grunau) - drm: apple: backlight: release lock in error path (Caspar Schutijser) - drm/apple: fix double words in comments (Jonathan Gray) - drm: apple: audio: Avoid probe errors (Janne Grunau) - drm: apple: audio: Make the DP/HDMI audio driver a full driver (Janne Grunau) - drm: apple: audio: move the audio driver into the DCP module (Janne Grunau) - drm: apple: av: Use a workqueue (Janne Grunau) - drm: apple: audio: init AV endpoint later (Janne Grunau) - drm: apple: dptx: Remove DPTX disconnect/connect on init (Janne Grunau) - gpu: drm: apple: Add DCP audio driver (Martin Povišer) - drm: apple: av: Do not open AV service from afk receive handler (Janne Grunau) - drm: apple: av: Support macOS 12.3 and 13.5 firmware APIs (Janne Grunau) - gpu: drm: apple: Set up client of AV endpoint (Martin Povišer) - gpu: drm: apple: Expose injecting of EPIC calls via debugfs (Martin Povišer) - drm: apple: iomfb: export property dicts in connector debugfs (Janne Grunau) - drm: apple: Add Kconfig option for audio (Janne Grunau) - drm: apple: dptx: Debounce HPD by simple msleep() (Janne Grunau) - drm: apple: Fix/remove log messages (Janne Grunau) - drm: apple: backlight: force backlight update after resume (Mark Kettenis) - drm/apple: spelling fixes (Jonathan Gray) - drm/apple: Add missing RTKit Kconfig dependency (Alyssa Ross) - drm: apple: mark local functions static (Arnd Bergmann) - drm: apple: epic: systemep: Parse "mNits" log events (Janne Grunau) - drm: apple: epic: Pass full notfiy/report payload to handler (Janne Grunau) - drm: apple: parser: constify parser data (Janne Grunau) - drm: apple: iomfb: Always parse DisplayAttributes (Janne Grunau) - drm: apple: Prefer RGB SDR modes (Janne Grunau) - drm: apple: dptx: Wait for link config on connect (Janne Grunau) - drm: apple: Be less noisy about teardown notifies without service (Janne Grunau) - drm: apple: dcp: Fix resume with DPTX based display outputs (Janne Grunau) - drm: apple: Adjust startup sequence and timing for dptx (Janne Grunau) - drm: apple: iomfb: Extend hotplug/mode parsing logging (Janne Grunau) - drm : apple: iomfb: Handle OOB ASYNC/CB context (Janne Grunau) - drm: apple: iomfb: Use drm_kms_helper_connector_hotplug_event (Janne Grunau) - drm: apple: Fix DPTX hotplug handling (Janne Grunau) - drm: apple: Move modeset into drm_crtc's atomic_enable (Janne Grunau) - drm: apple: dptx: Log connect/disconnect calls (Janne Grunau) - drm: apple: Extract modeset crtc's atomic_flush() (Janne Grunau) - drm: apple: iomfb: Improve hotplug related logging (Janne Grunau) - drm: apple: HPD: Only act on connect IRQs (Janne Grunau) - drm: apple: dptx: Wait for completion of dptx_connect. (Janne Grunau) - drm: apple: Disconnect dptx When the CRTC is powered down (Janne Grunau) - drm: apple: dptx: Implement APCALL_DEACTIVATE and reset the phy (Janne Grunau) - Revert "drm: apple: iomfb: Do not match/create PMU service for dcpext" (Janne Grunau) - drm: apple: Keep information at which swap_id fb are still referenced (Janne Grunau) - drm: apple: Implement D592 callback (Janne Grunau) - drm: apple: afk: Update read pointer before processing message (Janne Grunau) - drm: apple: HACK: Do not delete piodma platform device (Janne Grunau) - drm: apple: dptxep: Implement drive settings stuff (Hector Martin) - drm: apple: dptxep: Fix reply size check (Hector Martin) - drm: apple: Fix missing unlock path in dcp_dptx_connect (Hector Martin) - drm: apple: afk: Clear commands before sending them (Hector Martin) - drm: apple: dptx: Adapt dptxport_connect() to observed behavior (Janne Grunau) - drm: apple: dptx: Add DPTX_APCALL_ACTIVATE (Janne Grunau) - drm: apple: dptx: Add set_active_lanes APCALL (Janne Grunau) - drm: apple: dptx: port interface to macOS 13.5 firmware (Janne Grunau) - drm: apple: dptx: Port APCALL to macOS 13.3 firmware (Janne Grunau) - drm: apple: afk: Adapt to macOS 13.3 firmware (Janne Grunau) - drm: apple: iomfb: Do not match/create PMU service for dcpext (Janne Grunau) - drm: apple: Move offsets for rt_bandwidth callback to DT (Janne Grunau) - drm: apple: Add DPTX support (Sven Peter) - drm: apple: afk: Use linear array of services (Janne Grunau) - drm: apple: DCP AFK/EPIC support (Sven Peter) - gpu: drm: apple: Add sound mode parsing (Martin Povišer) - gpu: drm: apple: Add 'parse_blob' (Martin Povišer) - gpu: drm: apple: Add utility functions for matching on dict keys (Martin Povišer) - mux: apple dp crossbar: Support t602x DP cross bar variant (Janne Grunau) - mux: apple dp crossbar: Read UNK_TUNABLE before and after writing it (Janne Grunau) - mux: apple dp crossbar: FIFO_RD_UNK_EN seems to use 2 bits per dispext* (Janne Grunau) - mux: apple dp crossbar: Support t8112 varient (Janne Grunau) - mux: apple DP xbar: Add Apple silicon DisplayPort crossbar (Sven Peter) - drm: apple: Remove explicit asc-dram-mask handling (Janne Grunau) - drm: apple: iomfb: Increase modeset tiemout to 8.5 seconds (Janne Grunau) - drm: apple: iomfb: implement abort_swaps_dcp (Janne Grunau) - drm: apple: dcp: Remove cargo-culted devm_of_platform_populate (Janne Grunau) - drm: apple: dcp: Port over to DEFINE_SIMPLE_DEV_PM_OPS (Janne Grunau) - drm: apple: Update supported firmware versions to 12.3 and 13.5 (Janne Grunau) - drm: apple: Add D129 allocate_bandwidth iomfb callback (Janne Grunau) - drm: apple: Align PIODMA buffers to SZ_16K (Janne Grunau) - drm/apple: Use iommu domain for piodma maps (Janne Grunau) - drm/apple: Get rid of the piodma dummy driver (Janne Grunau) - drm: apple: backlight: avoid updating the brightness with a commit (Janne Grunau) - drm: apple: iomfb: limit backlight updates to integrated panels (Janne Grunau) - drm: apple: Only match backlight service on DCP with panel (Janne Grunau) - drm: apple: iomfb: Increase modeset timeout to 2.5 seconds (Janne Grunau) - drm/apple: Mark DCP as being in the wakeup path (Hector Martin) - drm/apple: Remove simpledrm framebuffer before DRM device alloc (Janne Grunau) - WIP: drm/apple: Port to incompatible V13.3 firmware interface (Janne Grunau) - dcp: Warn if DMA mapping fails (Hector Martin) - dcp: T602X bwreq support (Hector Martin) - dcp: 42-bit DMA masks (Hector Martin) - dcp: Add get_tiling_state (Hector Martin) - dcp: Allow unused trampolines (Hector Martin) - drm/apple: Drop unsupported DRM_FORMAT_ARGB2101010 (Janne Grunau) - drm/apple: Support color transformation matrices (Janne Grunau) - drm/apple: ignore surf[3] in clear swap calls (Janne Grunau) - drm/apple: Add support for the macOS 13.2 DCP firmware (Janne Grunau) - drm/apple: Add callbacks triggered by last_client_close_dcp() (Janne Grunau) - drm/apple: purge unused dcp_update_notify_clients_dcp (Janne Grunau) - drm/apple: Align buffers to 16K page size (Asahi Lina) - drm/apple: Move panel options to its own sub-struct (Janne Grunau) - drm/apple: Use backlight_get_brightness() (Janne Grunau) - drm/apple: Set backlight level indirectly if no mode is set (Janne Grunau) - drm/apple: Fix bad error return (Asahi Lina) - drm/apple: Fix parse_string() memory leaks (Asahi Lina) - drm/apple: simplify IOMFB_THUNK_INOUT (Janne Grunau) - gpu: drm: apple: Wait for iomfb initialization (Janne Grunau) - gpu: drm: apple: Use components to avoid deferred probing (Janne Grunau) - drm/apple: Allocate drm objects according to drm's expectations (Janne Grunau) - drm/apple: Use drm_module_platform_driver (Janne Grunau) - gpu: drm: apple: Use aperture_remove_conflicting_devices (Janne Grunau) - drm/apple: Update swap handling (Janne Grunau) - gpu: drm: apple: Clear all surfaces on startup (Janne Grunau) - drm/apple: Enable 10-bit mode & set colorspace to native (Hector Martin) - Revert "gpu: drm: apple: reenable support for {A,X}RGB2101010" (Janne Grunau) - gpu: drm: apple: Add show_notch module parameter (Janne Grunau) - gpu: drm: apple: reenable support for {A,X}RGB2101010 (Janne Grunau) - gpu: drm: apple: Add IOMobileFramebufferAP::get_color_remap_mode (Janne Grunau) - gpu: drm: apple: Prefer SDR color modes (Janne Grunau) - gpu: drm: apple: Add tracing for color and timing modes (Janne Grunau) - gpu: drm: apple: Skip parsing elements of virtual timing modes (Janne Grunau) - gpu: drm: apple: Parse color modes completely (Janne Grunau) - drm/apple: Disable fake vblank IRQ machinery (Asahi Lina) - drm/apple: Check if DCP firmware is supported (Janne Grunau) - drm/apple: Report "PMUS.Temperature" only for mini-LED backlights (Janne Grunau) - drm/apple: Schedule backlight update on enable_backlight_message_ap_gated (Janne Grunau) - drm/asahi: Fix backlight restores on non-microLED devices (Asahi Lina) - drm/apple: Remove obsolete ignore_swap_complete (Asahi Lina) - drm/apple: Wait for power on request to complete synchronously (Asahi Lina) - drm/apple: Read display dimensions from devicetree (Janne Grunau) - drm/apple: Implement drm_crtc_helper_funcs.mode_fixup (Janne Grunau) - drm/apple: Add trace point for display brightness (Janne Grunau) - drm/apple: register backlight device after IOMFB start (Janne Grunau) - gpu: drm: apple: Avoid drm_fb_dma_get_gem_addr (Janne Grunau) - drm/apple: Fix suspend/resume handling (Hector Martin) - HACK: gpu: drm: apple: j314/j316: Ignore 120 Hz mode for integrated display (Janne Grunau) - gpu: drm: apple: Brightness control via atomic commits (Janne Grunau) - gpu: drm: apple: "match" PMU/backlight services on init (Janne Grunau) - gpu: drm: apple: iomfb: Unify call and callback channels (Janne Grunau) - gpu: drm: apple: iomfb: Use FIELD_{GET,PREP} (Janne Grunau) - gpu: drm: apple: Prevent NULL pointer in dcp_hotplug (Janne Grunau) - gpu: drm: apple: Set maximal framebuffer size correctly (Janne Grunau) - gpu: drm: apple: Fix shutdown of partially probed dcp (Janne Grunau) - gpu: drm: apple: Provide notch-less modes (Janne Grunau) - gpu: drm: apple: Support opaque pixel formats (Janne Grunau) - gpu: drm: apple: Remove other framebuffers before DRM setup (Janne Grunau) - gpu: drm: apple: Specify correct number of DCP*s for drm_vblank_init (Janne Grunau) - gpu: drm: apple: Fix DCP initialisation (Janne Grunau) - gpu: drm: apple: Fix DCP run time PM (Janne Grunau) - gpu: drm: apple: Add dcp_crtc_atomic_check (Janne Grunau) - gpu: drm: apple: Send an disconnected hotplug event on ASC crash (Janne Grunau) - gpu: drm: apple: Convert 2 non-assert WARN()s to dev_err() (Janne Grunau) - gpu: drm: apple: Reject modes without valid color mode (Janne Grunau) - gpu: drm: apple: Add apple_drm_gem_dumb_create() (Janne Grunau) - gpu: drm: apple: Add support for DRM_FORMAT_XRGB2101010 (Janne Grunau) - gpu: drm: apple: Unbreak multiple DCP plane <-> crtc matching (Janne Grunau) - gpu: drm: apple: Start using tracepoints (Janne Grunau) - drm: apple: Replace atomic refcount with kref (Janne Grunau) - drm: apple: Fix connector state on devices with integrated display (Janne Grunau) - gpu: drm: apple: Use connector types from devicetree (Janne Grunau) - WIP: add header test target copied from i915 (Janne Grunau) - drm/apple: Split dcpep/iomfb out of dcp.c (Janne Grunau) - drm/apple: make note about drm.mode_config.max_width/height (Janne Grunau) - drm/apple: Mark the connecter on init only with modes as connected (Janne Grunau) - drm/apple: Allow modesets even when disconnected (Janne Grunau) - drm/apple: Fix kzalloc in dcp_flush() (Asahi Lina) - drm/apple: laod piodma dev via explicit phandle (Janne Grunau) - WIP: drm/apple: Change the way to clear unused surfaces (Janne Grunau) - drm/apple: Support memory unmapping/freeing (Janne Grunau) - drm/apple: clear callback's output data (Janne Grunau) - drm/apple: implement read_edt_data (Janne Grunau) - drm/apple: Add less tons of questionable debug prints (Janne Grunau) - drm/apple: Add somewhat useful debug prints (Janne Grunau) - drm/apple: toggle power only when active state changes (Janne Grunau) - drm/apple: Add t600x support (Janne Grunau) - drm/apple: Clear used callback/cookie on dcp_ack (Janne Grunau) - drm/apple: Add DCP interface definitions used on t600x (Janne Grunau) - drm/apple: Log callbacks with their tag as debug output (Janne Grunau) - drm/apple: Switch to nonblocking commit handling (Janne Grunau) - drm/apple: dcp: fix TRAMPOLINE_IN macro (Janne Grunau) - drm/apple: Implement suspend/resume for DCP (Alyssa Rosenzweig) - drm/apple: Use "apple,asc-dram-mask" for rtkit iovas (Janne Grunau) - drm/apple: Reference only swapped out framebuffers (Janne Grunau) - drm/apple: Add nop sr_set_uint_prop callback for t600x-dcp (Janne Grunau) - drm/apple: Fix rt_bandwidth for t600x (Janne Grunau) - drm/apple: Use a device tree defined clock for dcpep_cb_get_frequency (Janne Grunau) - HACK: drm/apple: avoid DCP swaps without attached surfaces (Janne Grunau) - drm/apple: Start coprocessor on probe (Janne Grunau) - drm: apple: Relicense DCP driver as dual MIT / GPL v2.0 (Janne Grunau) - WIP: drm/apple: Add DCP display driver (Alyssa Rosenzweig) - rust: helpers: Add dma_mapping_error() helper (Sasha Finkelstein) - rust: io: Add helper for memcpy_toio (Sasha Finkelstein) - Rust: io: Add memcpy_fromio wrapper (Asahi Lina) - rust: kernel: {arc, kbox}: use pin_coerce_unsized_trait (Janne Grunau) - rust: add unstable feature associated_type_defaults (Janne Grunau) - rust: Enable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: kernel: workqueue: Disable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: print: Disable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: init: macros: Disable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: init: Disable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: init: Add default() utility function (Asahi Lina) - rust: bindgen: Exclude list functions with unsupported ABIs (Asahi Lina) - rust: of: Add wrapper for of_property_present() (Janne Grunau) - rust: of: Add Node::address_as_resource() (Asahi Lina) - rust: page: Add physical address conversion functions (Asahi Lina) - rust: addr: Add a module to declare core address types (Asahi Lina) - rust: page: Make with_page_mapped() and with_pointer_into_page() public (Asahi Lina) - rust: page: Convert to Ownable (Asahi Lina) - rust: Add Ownable/Owned types (Asahi Lina) - HACK: rust: of: add as_raw() (Janne Grunau) - rust: of: Add parse_phandle_by_name() (Janne Grunau) - rust: Fix x86 build (Hector Martin) - rust: of: Add OF node abstraction (Asahi Lina) - rust: device: Add Device::parent() (Sasha Finkelstein) - rust: soc: apple: rtkit: Add Apple RTKit abstraction (Asahi Lina) - rust: xarray: Add an abstraction for XArray (Asahi Lina) - *RFL import: kernel::delay (Asahi Lina) - rust: Add time_namespace helpers (Asahi Lina) - rust: time: New module for timekeeping functions (Asahi Lina) - rust: sync: arc: Add lockdep integration (Asahi Lina) - rust: sync: Add LockdepMap abstraction (Asahi Lina) - rust: init: Update documentation for new mutex init style (Asahi Lina) - rust: sync: Classless Lock::new() and pin_init() (Asahi Lina) - rust: sync: Implement dynamic lockdep class creation (Asahi Lina) - rust: sync: Replace static LockClassKey refs with a pointer wrapper (Asahi Lina) - rust: sync: Add dummy LockClassKey implementation for !CONFIG_LOCKDEP (Asahi Lina) - Revert "rust: lockdep: Remove support for dynamically allocated LockClassKeys" (Janne Grunau) - rust: kernel: Add simple siphash abstraction (Asahi Lina) - rust: Use absolute paths to build Rust objects (Asahi Lina) - rust: types: Add Opaque::zeroed() (Asahi Lina) - rust: init: Support type paths in pin_init!() and friends (Asahi Lina) - rust: init: Implement Zeroable::zeroed() (Asahi Lina) - rust: kernel: lock: Add Lock::pin_init() (Asahi Lina) - rust: str: allow dereferencing BStr in a const ctx (Fabien Parent) - rust: alloc: Flags: Switch to declare_flags_type!() macro. (Asahi Lina) - rust: types: Add declare_flags_type() (Asahi Lina) - rust: alloc: Add .resize() to Vec (Sasha Finkelstein) - rust: alloc: vec: Import .drain() / Drain from rust library (Janne Grunau) - rust: alloc: vec: Add TryFrom trait (Janne Grunau) - rust: alloc: Vec: Implement .clear()/.truncate() (Janne Grunau) - rust: alloc: kbox: Add CoerceUnsized trait (Janne Grunau) - rust: alloc: kbox: Add AsRef implementation to Box (Sasha Finkelstein) - rust: allocator: Disable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: Add a Sealed trait (Asahi Lina) - rust: error: Add ENOSYS from uapi/asm-generic/errno.h (Janne Grunau) - rust: error: Add ECANCELED from uapi/asm-generic/errno.h (Janne Grunau) - rust: error: Add ENODATA from uapi/asm-generic/errno.h (Janne Grunau) - rust: error: Add ETIMEDOUT from uapi/asm-generic/errno.h (Janne Grunau) - rust: dma: add as_slice/write functions for CoherentAllocation (Abdiel Janulgue) - rust: platform: implement the `dma::Device` trait (Danilo Krummrich) - rust: pci: implement the `dma::Device` trait (Danilo Krummrich) - rust: dma: add dma addressing capabilities (Danilo Krummrich) - rust: dma: implement `dma::Device` trait (Danilo Krummrich) - modules: add rust modules files to MAINTAINERS (Andreas Hindborg) - rust: add parameter support to the `module!` macro (Andreas Hindborg) - rust: str: add radix prefixed integer parsing functions (Andreas Hindborg) - rust: io: mem: Add Mem abstraction (Asahi Lina) - rust: io: mem: Support non-posted write semantics (Janne Grunau) - rust: io: resource: Add resource flag IORESOURCE_MEM_NONPOSTED (Janne Grunau) - rust: io: add resource abstraction (ffi fixes) (Janne Grunau) - rust: platform: allow ioremap of platform resources (Daniel Almeida) - rust: io: mem: add a generic iomem abstraction (Daniel Almeida) - rust: io: add resource abstraction (Daniel Almeida) - rust: str: implement `strip_prefix` for `BStr` (Andreas Hindborg) - rust: str: implement `AsRef` for `[u8]` and `BStr` (Andreas Hindborg) - rust: str: implement `Index` for `BStr` (Andreas Hindborg) - rust: str: implement `PartialEq` for `BStr` (Andreas Hindborg) - MAINTAINERS: add entry for Rust dma mapping helpers device driver API (Abdiel Janulgue) - rust: add dma coherent allocator abstraction (Abdiel Janulgue) - rust: error: Add EOVERFLOW (Abdiel Janulgue) - rust: module: introduce `authors` key (Guilherme Giacomo Simoes) - panic_qr: use new #[export] macro (Alice Ryhl) - print: use new #[export] macro for rust_fmt_argument (Alice Ryhl) - rust: add #[export] macro (Alice Ryhl) - rust: macros: support additional tokens in quote! (Alice Ryhl) - dmaengine: apple-sio: Implement runtime PM (Janne Grunau) - dmaengine: apple-sio: Fix chan freeing in error path (Asahi Lina) - dmaengine: apple-sio: Add Apple SIO driver (Martin Povišer) - dt-bindings: dma: apple,sio: Add schema (Martin Povišer) - phy: apple: atc: Ensure DP mode is used for DP-only ATC phys (Janne Grunau) - phy: apple: atc: Add missing mutex_unlock in error case (Janne Grunau) - phy: apple: dptx: Add debug prints for unexpected values (Janne Grunau) - phy: apple: atc: support mode switches in atcphy_dpphy_set_mode() (Janne Grunau) - HACK: phy: apple: atc: Ignore fake submodes (Janne Grunau) - phy: apple: atc: Support 'set_lanes' in DP mode (Janne Grunau) - phy: apple: atc: Support DisplayPort only operation (Janne Grunau) - phy: apple: atc: Reorder ACIOPHY_CROSSBAR and ACIOPHY_MISC ops (Janne Grunau) - phy: apple: atc: Split atcphy_dp_configure_lane() (Janne Grunau) - phy: apple: Add DP TX phy driver (Janne Grunau) - usb: typec: tipd: Clear interrupts first (Sven Peter) - WIP: phy: apple: Add Apple Type-C PHY (Sven Peter) - nvmem: round up to word_size (Sven Peter) - nvmem: allow bit offset > 8 (Sven Peter) - Revert "nvmem: core: Print error on wrong bits DT property" (Janne Grunau) - xhci-pci: asmedia: Add a firmware loader for ASM2214a chips (Hector Martin) - PCI: apple: Avoid PERST# deassertion through gpiod initialization (Janne Grunau) - PCI: apple: Log the time it takes for links to come up (Hector Martin) - PCI: apple: Reorder & improve link-up logic (Hector Martin) - PCI: apple: Make link up timeout configurable, default to 500ms (Hector Martin) - PCI: apple: Skip controller port setup for online links (Janne Grunau) - PCI: apple: Add support for optional PWREN GPIO (Hector Martin) - PCI: apple: Probe all GPIOs for availability first (Hector Martin) - dt-bindings: pci: apple,pcie: Add subnode binding, pwren-gpios property (Hector Martin) - PCI: apple: Add T602x PCIe support (Hector Martin) - PCI: apple: Abstract register offsets via a SoC-specific structure (Hector Martin) - PCI: apple: Use gpiod_set_value_cansleep in probe flow (Hector Martin) - PCI: apple: Drop poll for CORE_RC_PHYIF_STAT_REFCLK (Hector Martin) - PCI: apple: Move port PHY registers to their own reg items (Hector Martin) - PCI: apple: Set only available ports up (Janne Grunau) - PCI: apple: Fix missing OF node reference in apple_pcie_setup_port (Hector Martin) - PCI: apple: Move away from INTMSK{SET,CLR} for INTx and private interrupts (Marc Zyngier) - PCI: apple: Dynamically allocate RID-to_SID bitmap (Marc Zyngier) - PCI: apple: Move over to standalone probing (Marc Zyngier) - PCI: ecam: Allow cfg->priv to be pre-populated from the root port device (Marc Zyngier) - PCI: host-generic: Extract an ecam bridge creation helper from pci_host_common_probe() (Marc Zyngier) - dt-bindings: pci: apple,pcie: Add t6020 compatible string (Alyssa Rosenzweig) - nvmem: spmi-mfd-nvmem: use legacy fixed layout (Janne Grunau) - nvmem: Add spmi-mfd-nvmem driver (Hector Martin) - mfd: Add a simple-mfd-spmi driver (Hector Martin) - spmi: add a first basic spmi driver for Apple SoC (Jean-Francois Bortolotti) - macsmc: power: ac: Report only supported properties (Janne Grunau) - macsmc: rtkit: Return -EIO instead of negated SMC results (Janne Grunau) - hwmon: macsmc: wire up manual fan control support (James Calligeros) - platform/apple: smc: Add apple_smc_write_f32_scaled (Janne Grunau) - power: supply: macsmc_power: Report not charging for CHLS thresholds (Janne Grunau) - power: supply: macsmc_power: Remove CSIL (Hector Martin) - power: supply: macsmc_power: Add CHLS charge thresholds (Hector Martin) - hwmon: macsmc: Avoid global writable hwmon_chip_info (Janne Grunau) - hwmon: add macsmc-hwmon driver (James Calligeros) - platform/apple: smc: Add apple_smc_read_ioft_scaled (Janne Grunau) - power: supply: macsmc_power: Add more properties (Hector Martin) - power: supply: macsmc_power: Report available charge_behaviours (Thomas Weißschuh) - power: supply: macsmc_power: Add CHWA charge thresholds (Hector Martin) - power: supply: macsmc_power: Log power data on button presses (Hector Martin) - macsmc: Fix race between backend and core on notifications (Hector Martin) - power: supply: macsmc_power: Add a debug mode to print power usage (Hector Martin) - platform/apple: smc: Add apple_smc_read_f32_scaled (Hector Martin) - power: supply: macsmc_power: Add critical level shutdown & misc events (Hector Martin) - Input: macsmc-hid: Support the power button on desktops (Hector Martin) - gpio: macsmc: Add IRQ support (Hector Martin) - Input: macsmc-hid: Support button/lid wakeups (Hector Martin) - Input: macsmc-hid: New driver to handle the Apple Mac SMC buttons/lid (Hector Martin) - rtc: Add new rtc-macsmc driver for Apple Silicon Macs (Hector Martin) - power: reset: macsmc-reboot: Add driver for rebooting via Apple SMC (Hector Martin) - power: supply: macsmc_power: Add AC power supply (Hector Martin) - power: supply: macsmc_power: Turn off OBC flags if macOS left them on (Hector Martin) - power: supply: macsmc_power: Use BUIC instead of BRSC for charge (Hector Martin) - power: supply: macsmc_power: Add more props, rework others (Hector Martin) - power: supply: macsmc_power: Add present prop (Hector Martin) - power: supply: macsmc_power: Add cycle count and health props (Hector Martin) - power: supply: macsmc_power: Driver for Apple SMC power/battery stats (Hector Martin) - gpio: Add new gpio-macsmc driver for Apple Macs (Hector Martin) - platform/apple: Add new Apple Mac SMC driver (Hector Martin) - lib/vsprintf: Add support for generic FOURCCs by extending %p4cc (Hector Martin) - DO NOT MERGE: HID: apple: Add fnmode which ignores function keys (Janne Grunau) - HID: transport: spi: apple: Use distinctive names input devices (Janne Grunau) - HID: transport: spi: apple: Increase receive buffer size (Janne Grunau) - HID: magicmouse: Query device dimensions via HID report (Hector Martin) - HID: transport: spi: Implement GET FEATURE (Hector Martin) - HID: magicmouse: Handle touch controller resets on SPI devices (Hector Martin) - HID: Bump maximum report size to 16384 (Hector Martin) - HID: transport: spi: Add suspend support (Janne Grunau) - HID: magicmouse: Add .reset_resume for SPI trackpads (Janne Grunau) - HID: transport: spi: Check status message after transmits (Janne Grunau) - soc: apple: Add RTKit helper driver (Hector Martin) - hid: Add Apple DockChannel HID transport driver (Hector Martin) - soc: apple: Add DockChannel driver (Hector Martin) - hid: magicmouse: Add MTP multi-touch device support (Hector Martin) - hid: apple: Bind to HOST devices for MTP (Hector Martin) - HID: core: Handle HOST bus type when announcing devices (Hector Martin) - HID: add HOST vendor/device IDs for Apple MTP devices (Hector Martin) - WIP: HID: transport: spi: add Apple SPI transport (Janne Grunau) - HID: magicmouse: add support for Macbook trackpads (Janne Grunau) - HID: magicmouse: use ops function pointers for input functionality (Janne Grunau) - HID: magicmouse: use struct input_mt_pos for X/Y (Janne Grunau) - HID: magicmouse: use a define of the max number of touch contacts (Janne Grunau) - HID: apple: add Fn key mapping for Macbook Pro with touchbar (Janne Grunau) - HID: apple: add Fn key mapping for Apple silicon MacBooks (Janne Grunau) - HID: apple: add support for internal keyboards (Janne Grunau) - HID: add device IDs for Apple SPI HID devices (Janne Grunau) - fixup! wifi: brcmfmac: Add support for firmware signatures (Janne Grunau) - [brcmfmac] Disable partial SAE offload (Daniel Berlin) - [brcmfmac] Clean up and common interface creation handling (Daniel Berlin) - [brcmfmac] Support bandwidth caps for all bands (Daniel Berlin) - [brcmfmac] Add support for more rate info in station dumps (Daniel Berlin) - [brcmfmac] Set chanspec during join. (Daniel Berlin) - [brcmfmac] Add support for more auth suites in roaming offload (Daniel Berlin) - [brcmfmac] Let feature attachment fail, and fail if we can't handle the interface versions we find. (Daniel Berlin) - [brcmfmac] Support new join parameter structure versions (Hector Martin) - [brcmfmac] Structurize scan parameter handling (Daniel Berlin) - [brcmfmac] Structurize PNF scan and add support for latest version (Daniel Berlin) - fixup! define missing event message extension (Daniel Berlin) - fixup! fix FWIL definition to use SSID length constant (Daniel Berlin) - [brcmfmac] Fix regulatory domain handling to reset bands properly (Daniel Berlin) - [brcmfmac] Add support for 6G bands and HE (Daniel Berlin) - [brcmfmac] Support high power/low power/etc scan flags (Daniel Berlin) - [brcmfmac] Support GCMP cipher suite, used by WPA3. (Daniel Berlin) - [brcmfmac] Compute number of available antennas and set it in wiphy structure. (Daniel Berlin) - [brcmfmac] Dynamically configure VHT settings to match firmware (Daniel Berlin) - [brcmfmac] Add support for encoding/decoding 6g chanspecs (Daniel Berlin) - [brcmfmac] Finish firmware mem map, fix heap start calculation bug. (Daniel Berlin) - brcmfmac: Fix AP mode (Patrick Blass) - wifi: brcmfmac: Add BCM4388 support (Hector Martin) - wifi: brcmfmac: Extend brcmf_wsec_pmk_le (Hector Martin) - wifi: brcmfmac: Support bss_info up to v112 (Hector Martin) - wifi: brcmfmac: Implement event_msgs_ext (Hector Martin) - wifi: brcmfmac: Add support for SCAN_V3 (Hector Martin) - wifi: brcmfmac: Mask all IRQs before starting firmware (Hector Martin) - wifi: brcmfmac: Do not set reset vector when signatures are in use (Hector Martin) - wifi: brcmfmac: pcie: Initialize IRQs before firmware boot (Hector Martin) - wifi: brcmfmac: pcie: Access pcie core registers via dedicated window (Hector Martin) - wifi: brcmfmac: Handle watchdog properly in newer cores (Hector Martin) - wifi: brcmfmac: chip: ca7: Only disable D11 cores; handle an arbitrary number (Hector Martin) - wifi: brcmfmac: Increase bandlist size (Hector Martin) - wifi: brcmfmac: msgbuf: Increase RX ring sizes to 2048 (Hector Martin) - wifi: brcmfmac: Add support for firmware signatures (Hector Martin) - wifi: brcmfmac: Add support for SYSMEM corerev >= 12 & fix < 12 (Hector Martin) - wifi: brcmfmac: Do not service msgbuf IRQs until ready in MSI mode (Hector Martin) - wifi: brcmfmac: Shut up p2p unknown frame error (Hector Martin) - wifi: brcmfmac: Support exchanging power mailbox messages via commonring (Hector Martin) - wifi: brcmfmac: Implement the H2D/D2H mailbox data commonring messages (Hector Martin) - wifi: brcmfmac: Add a new bus op for D2H mailbox message handling (Hector Martin) - wifi: brcmfmac: Add newer msgbuf packet types up to 0x2e (Hector Martin) - wifi: brcmfmac: Support v6+ flags and set host_cap properly (Hector Martin) - wifi: brcmfmac: Fix logic for deciding which doorbell registers to use (Hector Martin) - wifi: brcmfmac: Handle PCIe MSI properly (Hector Martin) - wifi: brcmfmac: Add missing shared area defines to pcie.c (Hector Martin) - fixup! ASoC: macaudio: Sense improvements (Janne Grunau) - fixup! ASoC: macaudio: Sense improvements (Janne Grunau) - fixup! ASoC: macaudio: Sense improvements (Janne Grunau) - fixup! ASoC: apple: Add macaudio machine driver (Janne Grunau) - soc: apple: rtkit: Add tracekit endpoint. (Sasha Finkelstein) - soc: apple: rtkit: Add apple_rtkit_has_endpoint() (Sasha Finkelstein) - DO NOT MERGE: dmaengine: apple-admac: Add temporary aop-admac compatible (Sasha Finkelstein) - READ COMMIT MESSAGE! macaudio: Enable second round of models (Hector Martin) - READ COMMIT MESSAGE! macaudio: Enable first round of models (Hector Martin) - ALSA: Support nonatomic dmaengine PCMs (Martin Povišer) - HACK: ALSA: Export 'snd_pcm_known_rates' (Martin Povišer) - fixup! dmaengine: apple-admac: Add Apple ADMAC driver (Martin Povišer) - macaudio: Fix missing kconfig requirement (Sasha Finkelstein) - ASoC: apple: mca: More delay (Hector Martin) - ASoC: apple: mca: Add more delay after configuring clock (Hector Martin) - macaudio: Disable j313 and j274 (Hector Martin) - ASoC: apple: mca: Add delay after configuring clock (Hector Martin) - macaudio: Avoid matches against cs42l84's constrols (Janne Grunau) - macaudio: Fix CHECK return condition checking (Hector Martin) - macaudio: Sync all gains with macOS (Hector Martin) - macaudio: Turn please_blow_up_my_speakers into an int (Hector Martin) - macaudio: Change device ID form Jxxx to AppleJxxx (Hector Martin) - macaudio: Set the card name explicitly (Hector Martin) - ASoC: tas2770: Set the SDOUT polarity correctly (Hector Martin) - macaudio: Officially enable j313 speakers (Hector Martin) - macaudio: Skip speaker sense PCM if no sense or no speakers (Hector Martin) - macaudio: Remove -3dB safety pad from j313 (Hector Martin) - ASoC: tas2770: Support setting the PDM TX slot (Hector Martin) - ASoC: tas2770: Add zero-fill and pull-down controls (Hector Martin) - ASoC: tas2770: Power cycle amp on ISENSE/VSENSE change (Hector Martin) - ASoC: tas2770: Add SDZ regulator (Hector Martin) - macaudio: Rework platform config & add all remaining platforms (Hector Martin) - ASoC: tas2764: Enable some Apple quirks by default (Hector Martin) - ASoC: tas2764: Wait for ramp-down after shutdown (Hector Martin) - ALSA: dmaengine: Always terminate DMA when a PCM is closed (Hector Martin) - ASoC: apple: mca: Increase reset timeout (Hector Martin) - ASoC: tas2764: Mark SW_RESET as volatile (Hector Martin) - ASoC: tas2764: Add reg defaults for TAS2764_INT_CLK_CFG (Hector Martin) - macaudio: Use an explicit mutex for the speaker volume lock (Hector Martin) - ASoC: tas2764: Add SDZ regulator (Hector Martin) - ASoC: tas2764: Power up/down amp on mute ops (Hector Martin) - ASoC: tas2764: Enable main IRQs (Hector Martin) - macaudio: Disable debug (Hector Martin) - macaudio: Use the same volume limit for all amps (Hector Martin) - macaudio: Initialize speaker lock properly (Hector Martin) - macaudio: Enable VSENSE switches (Hector Martin) - macaudio: Allow DT enabled speakers and gate them off in the driver (Hector Martin) - ASoC: apple: mca: Do not mark clocks in use for non-providers (Hector Martin) - macaudio: Add a getter for the interlock (Hector Martin) - alsa: pcm: Remove the qos request only if active (Hector Martin) - macaudio: speaker volume safety interlocks (Hector Martin) - ASoC: ops: Export snd_soc_control_matches() (Hector Martin) - ASoC: macaudio: Sense improvements (Hector Martin) - ASoC: macaudio: Fix PD link double-frees? (Hector Martin) - ASoC: macaudio: Do not disable ISENSE/VSENSE switches on j314 (Martin Povišer) - ASoC: tas2764: Add optional 'Apple quirks' (Martin Povišer) - ASoC: macaudio: Add 'Speakers Up Indicator' control (Martin Povišer) - ASoC: macaudio: Remove stale 'speaker_nchans' fields (Martin Povišer) - ASoC: tas2764: Crop SDOUT zero-out mask based on BCLK ratio (Martin Povišer) - ASoC: tas2764: Export 'die_temp' to sysfs (Martin Povišer) - ASoC: tas2770: Export 'die_temp' to sysfs (Martin Povišer) - ASoC: tas2764: Raise regmap range maximum (Martin Povišer) - WIP: ASoC: tas2764: Apply unknown Apple quirk (Martin Povišer) - ASoC: tas2764: Configure zeroing of SDOUT slots (Martin Povišer) - ASoC: apple: mca: Support capture on multiples BEs (Martin Povišer) - ASoC: macaudio: Tune constraining of FEs, add BCLK (Martin Povišer) - NOT UPSTREAMABLE: ASoC: tas2764: Redo I/V sense logic (Martin Povišer) - ASoC: tas2764: Reinit cache on part reset (Martin Povišer) - ASoC: tas2770: Fix and redo I/V sense TDM slot setting logic (Martin Povišer) - ASoC: tas2770: Factor out set_ivsense_slots (Martin Povišer) - ASoC: macaudio: Do not constrain sense PCM (Martin Povišer) - ASoC: macaudio: Tweak "no audio route" message (Martin Povišer) - ASoC: macaudio: Start speaker sense capture support (Martin Povišer) - ASoC: apple: mca: Fix SYNCGEN enable on FE clock consumers (Martin Povišer) - ASoC: apple: mca: Support FEs being clock consumers (Martin Povišer) - ASoC: apple: mca: Factor out mca_be_get_fe (Martin Povišer) - ASoC: apple: mca: Separate data & clock port setup (Martin Povišer) - ASoC: macaudio: Tune DT parsing error messages (Martin Povišer) - ASoC: macaudio: Condition selecting NCO driver on COMMON_CLK (Martin Povišer) - ALSA: control: Add kcontrol callbacks for lock/unlock (Hector Martin) - ASoC: macaudio: alias j415 kcontrols to j314 (James Calligeros) - ASoC: apple: mca: Move clock shutdown to be shutdown (Hector Martin) - ASoC: cs42l42: Set a faster digital ramp-up rate (Hector Martin) - ASoC: macaudio: constrain frontend channel counts (James Calligeros) - ASoC: macaudio: Add initial j313 fixup_controls (Martin Povišer) - ASoC: macaudio: Improve message on opening of unrouted PCM devices (Martin Povišer) - ASoC: apple: mca: Constrain channels according to TDM mask (Martin Povišer) - ASoC: macaudio: Alias f413 fixups to j314 (Hector Martin) - ASoC: macaudio: Gate off experimental platforms (Hector Martin) - ASoC: macaudio: s/void_warranty/please_blow_up_my_speakers/ (Hector Martin) - ASoC: macaudio: s/Freq/Frequency/ in TAS2764 control (Martin Povišer) - ASoC: macaudio: Drop the 'inverse jack' speaker stuff (Martin Povišer) - ASoC: macaudio: Rename ALSA driver to simple 'macaudio' (Martin Povišer) - ASoC: macaudio: Add j493 fixup_controls (Martin Povišer) - ASoC: macaudio: Add j375 fixup_controls (Martin Povišer) - ASoC: dapm: Export new 'graph.dot' file in debugfs (Martin Povišer) - ASoC: macaudio: Fix headset routes (Martin Povišer) - ASoC: cs42l42: Do not advertise sample bit symmetry (Martin Povišer) - ASoC: cs42l42: Fix typo (Martin Povišer) - ASoC: apple: Add macaudio machine driver (Martin Povišer) - dt-bindings: sound: Add Apple Macs sound peripherals (Martin Povišer) - ASoC: card: Let 'fixup_controls' return errors (Martin Povišer) - ASoC: ops: Introduce 'soc_set_enum_kctl' (Martin Povišer) - ASoC: ops: Introduce 'snd_soc_deactivate_kctl' (Martin Povišer) - ASoC: ops: Accept patterns in snd_soc_limit_volume (Martin Povišer) - ASoC: ops: Enforce platform maximum on initial value (Martin Povišer) - ASoC: ops: Move guts out of snd_soc_limit_volume (Martin Povišer) - ASoC: tas2764: Add control concerning overcurrent events (Martin Povišer) - ASoC: tas2764: Extend driver to SN012776 (Martin Povišer) - Revert "ASoC: ops: Don't modify the driver's plaform_max when reading state" (Martin Povišer) - apple-nvme: defer cache flushes by a specified amount (Jens Axboe) - MAINTAINERS: Add Apple dwc3 bindings to ARM/APPLE (Hector Martin) - usb: dwc3: core: Allow phy suspend during init for role_switch_reset_quirk (Janne Grunau) - usb: dwc3: apple: Do not use host-vbus-glitches workaround (Janne Grunau) - usb: dwc3: Add support for Apple DWC3 (Sven Peter) - dt-bindings: usb: Add Apple dwc3 bindings (Sven Peter) - mmc: pci: gl9755: Quirk UHS-2 for Apple GL9755 (Janne Grunau) - mmc: sdhci-uhs2: Add quirk for devices with broken UHS-2 (Janne Grunau) - mmc: core: Skip SD UHS-II enumeration on missing UHS2 cap (Janne Grunau) - of: Workaround missing '#{address,size}-cells' properties [drop v6.13 + 2] (Janne Grunau) - Increase MAX_LOCKDEP_CHAIN_HLOCKS (Asahi Lina) - arm64: Increase kernel stack size to 32K (Asahi Lina) - drm/simpledrm: Set DMA and coherency mask (Janne Grunau) - HACK: Lol libwebrtc (Hector Martin) - soc: apple: apple-pmgr-pwrstate: Mark on-at-boot PDs as wakeup (Hector Martin) - tty: serial: samsung_tty: Mark as wakeup_path on no_console_suspend (Hector Martin) - soc: apple: apple-pmgr-pwrstate: Mark on-at-boot PDs as DEFER_OFF (Hector Martin) - PM: domains: Add a flag to defer power-off until all consumers probe (Hector Martin) - driver core: fw_devlink: Add fw_devlink_count_absent_consumers() (Hector Martin) - i2c: pasemi: Log bus reset causes (Hector Martin) - i2c: pasemi: Enable the unjam machine (Hector Martin) - usb: typec: tipd: Be more verbose about errors (Hector Martin) - i2c: pasemi: Improve timeout handling and error recovery (Hector Martin) - firmware_loader: Add /lib/firmware/vendor path (Hector Martin) - PCI: apple: Add depends on PAGE_SIZE_16KB (Janne Grunau) - mmc: sdhci-pci: Support setting CD debounce delay (Hector Martin) - mmc: sdhci-pci: Support external CD GPIO on all OF systems (Hector Martin) - of: Demote "Bad cell count" to debug message (Hector Martin) - tty: serial: samsung_tty: Support runtime PM (Hector Martin) - arm64: Enable IMP DEF PMUv3 traps on Apple M* (Oliver Upton) - KVM: arm64: Provide 1 event counter on IMPDEF hardware (Oliver Upton) - drivers/perf: apple_m1: Provide helper for mapping PMUv3 events (Oliver Upton) - KVM: arm64: Remap PMUv3 events onto hardware (Oliver Upton) - KVM: arm64: Advertise PMUv3 if IMPDEF traps are present (Oliver Upton) - KVM: arm64: Compute synthetic sysreg ESR for Apple PMUv3 traps (Oliver Upton) - KVM: arm64: Move PMUVer filtering into KVM code (Oliver Upton) - KVM: arm64: Use guard() to cleanup usage of arm_pmus_lock (Oliver Upton) - KVM: arm64: Drop kvm_arm_pmu_available static key (Oliver Upton) - KVM: arm64: Use a cpucap to determine if system supports FEAT_PMUv3 (Oliver Upton) - KVM: arm64: Always support SW_INCR PMU event (Oliver Upton) - KVM: arm64: Compute PMCEID from arm_pmu's event bitmaps (Oliver Upton) - drivers/perf: apple_m1: Support host/guest event filtering (Oliver Upton) - drivers/perf: apple_m1: Refactor event select/filter configuration (Oliver Upton) - iommu: apple-dart: Revert separate iommu_ops for locked/bypass DARTs (Janne Grunau) - iommu: apple-dart: Disallow identity domains for locked DARTs (Janne Grunau) - iommu: apple-dart: Support combinations of locked and unlocked DARTs (Janne Grunau) - fixup! iommu/dart: Support locked DARTs (Janne Grunau) - fixup! iommu/dart: Track if the DART is locked (Janne Grunau) - iommu/of: Free fwspec on probe deferrel (Janne Grunau) - iommu: apple-dart: Check for fwspec in the device probe path (Hector Martin) - iommu: apple-dart: Support specifying the DMA aperture in the DT (Hector Martin) - iommu: apple-dart: Add 4-level page table support (Hector Martin) - iommu: apple-dart: Make the hw register fields u32s (Hector Martin) - iommu: apple-dart: Clear stream error indicator bits for T8110 DARTs (Hector Martin) - iommu: io-pgtable: Add 4-level page table support (Hector Martin) - iommu: apple-dart: Enable runtime PM (Hector Martin) - iommu: apple-dart: Link to consumers with blanket RPM_ACTIVE (Martin Povišer) - iommu: apple-dart: Power on device when handling IRQs (Asahi Lina) - iommu: Handle translated device firmware mappings (Janne Grunau) - iommu: Rename iommu_create_device_direct_mappings() (Janne Grunau) - iommu: Parse translated reserved regions (Janne Grunau) - iommu: Add IOMMU_RESV_TRANSLATED for non 1:1 mapped reserved regions (Janne Grunau) - iommu/dart: Support locked DARTs (Alyssa Rosenzweig) - iommu/dart: Add iommu_ops for locked DARTs (Janne Grunau) - iommu/dart: Track if the DART is locked (Alyssa Rosenzweig) - iommu/dart: Use virtual memory ttbr entries in apple_dart_cfg (Janne Grunau) - iommu/dart: Use separate iommu_ops for DARTs w/o bypass (Janne Grunau) - iommu: apple-dart: fix potential null pointer deref (Qasim Ijaz) - iommu: apple-dart: Allow mismatched bypass support (Hector Martin) - iommu: apple-dart: Increase MAX_DARTS_PER_DEVICE to 3 (Hector Martin) - irqchip/apple-aic: Add support for AICv3 (Janne Grunau) - soc: apple: rtkit: Pass 0 as size for a NULL crashlog buffer (Janne Grunau) - soc: apple: rtkit: Use scope-based cleanup in apple_rtkit_crashlog_rx() (Janne Grunau) - soc: apple: rtkit: Fix use-after-free in apple_rtkit_crashlog_rx() (Harshit Mogalapalli) - cpuidle: apple: Do not load on unsupported Apple platforms (Janne Grunau) - cpuidle: apple: Add Apple SoC cpuidle driver (Hector Martin) - soc: apple: pmgr: Add externally-clocked property (Hector Martin) - soc: apple: pmgr: Add force-disable/force-reset (Asahi Lina) - dt-bindings: power: apple,pmgr-pwrstate: Add force-{disable,reset} (Asahi Lina) - soc: apple: Add driver for Apple PMGR misc controls (Hector Martin) - soc: apple: rtkit: Cut syslog messages after the first '\0' (Janne Grunau) - soc: apple: rtkit: Use high prio work queue (Janne Grunau) - soc: apple: rtkit: Add devm_apple_rtkit_free() (Janne Grunau) - soc: apple: rtkit: Implement OSLog buffers properly (Hector Martin) - soc: apple: rtkit: Add APPLE_RTKIT_PWR_STATE_INIT (Janne Grunau) - soc: apple: rtkit: Log failed buffer requests (Asahi Lina) - soc: apple: rtkit: Log failure to send messages (Asahi Lina) - soc: apple: rtkit: Check for failure to send mgmt messages & log (Asahi Lina) - HID: lenovo: Remove CONFIG_ACPI dependency (Janne Grunau) - ACPI: platform_profile: Add support for non-ACPI platforms (Armin Wolf) - watchdog: apple: set max_hw_heartbeat_ms instead of max_timeout (Florian Klink) - fixup! arm64: dts: apple: Add T602x GPU node (Janne Grunau) - arm64: dts: apple: t600x-j375: Move gpu properties to individual devices (Janne Grunau) - fixup! arm64: dts: apple: Add devicetree for Macbook Air (15-inch, M2, 2023) (Janne Grunau) - fixup! arm64: dts: apple: t8112: Add dcp/disp0 nodes (Janne Grunau) - fixup! arm64: dts: apple: t8112: Add dcp/disp0 nodes (Janne Grunau) - fixup! arm64: dts: apple: t600x: Add DCP power domain to missing devices (Janne Grunau) - fixup! arch: arm64: apple: Add dcp panel node for t8103 based laptops and imacs (Janne Grunau) - fixup! arch: arm64: apple: Add dcp panel node for t8103 based laptops and imacs (Janne Grunau) - fixup! arch: arm64: apple: Add dcp panel node for t8103 based laptops and imacs (Janne Grunau) - fixup! arch: arm64: apple: Add dcp panel node for t8103 based laptops and imacs (Janne Grunau) - fixup! arm64: dts: Add t600x GPU nodes (Janne Grunau) - arm64: dts: apple: Move PCIe-GE nodes intro their own file (Janne Grunau) - arm64: dts: apple: t6022-j180d: Delete non pcie-ge nodes (Janne Grunau) - arm64: dts: apple: touchbar: Mark ps_dispdfr_be as always-on (Janne Grunau) - arm64: dts: apple: t6022-j180d: Enable second HDMI port (Janne Grunau) - arm64: dts: apple: t6022-j180d: Add node for built-in PCIe devices (Janne Grunau) - arm64: dts: apple: t6022-j180d: Probe all PCIe devices (Janne Grunau) - arm64: dts: apple: aop: Add hack to enforce probe order (Janne Grunau) - arm64: dts: apple: t8103-j45x: Mark missing beamforming (Janne Grunau) - arm64: dts: apple: t8112-j493: Enable AOP (Janne Grunau) - arm64: dts: apple: t8112-j415: Enable AOP (Janne Grunau) - arm64: dts: apple: t8112-j413: Enable AOP (Janne Grunau) - arm64: dts: apple: t8103-j45x: Enable AOP (Janne Grunau) - arm64: dts: apple: t8103-j313: Enable AOP (Janne Grunau) - arm64: dts: apple: t8103-j293: Enable AOP (Janne Grunau) - arm64: dts: apple: t600x-j314-j316: Enable AOP (Janne Grunau) - arm64: dts: apple: Remove no-map from remaining agx regions (Asahi Lina) - arm64: dts: apple: Remove no-map from pagetables region (Asahi Lina) - arm64: dts: apple: Add AOP audio identifiers (Sasha Finkelstein) - arm64: dts: apple: Add SEP device tree nodes (Sasha Finkelstein) - arm64: dts: apple: Add AOP and subdevices (Sasha Finkelstein) - arm64: dts: apple: j474s: correct case of Mac mini (Jonathan Gray) - arm64: dts: apple: t602x-j4xx: Add SMC hwmon sensors (Janne Grunau) - arm64: dts: apple: t600x-j3xx: Add SMC hwmon sensors (Janne Grunau) - arm64: dts: apple: t8112: Add SMC hwmon sensors (Janne Grunau) - arm64: dts: apple: t8103: Add SMC hwmon sensors (Janne Grunau) - arm64: dts: apple: add common hwmon keys and fans (James Calligeros) - arm64: apple: t8112-j473: Enable sio explicitly (Janne Grunau) - arm64: apple: t8103-j274: Enable sio explicitly (Janne Grunau) - arm64: apple: t60x0/t60x1: Enable sio explicitly (Janne Grunau) - arm64: apple: t60xx: Enable DP/HMI audio nodes on all devices (Janne Grunau) - arm64: apple: t602x: Add sio and dpaudio device nodes (Janne Grunau) - arm64: apple: t600x: Add sio and dpaudio device nodes (Janne Grunau) - arm64: apple: t600x: Move dart_sio* to dieX (Janne Grunau) - arm64: apple: t8112: Add SIO, DPA nodes; hook up to DCP (Janne Grunau) - arm64: apple: t8103: Add SIO, DPA nodes; hook up to DCP (Martin Povišer) - arm64: apple: t602x: pmgr: SIO: Add audio, spi and uart power-domains (Janne Grunau) - arm64: apple: t600x: pmgr: SIO: Add audio, spi and uart power-domains (Janne Grunau) - arm64: apple: t8112-pmgr: SIO: Add audio, spi and uart power-domains (Janne Grunau) - arm64: apple: t8103-pmgr: SIO: Add audio, spi and uart power-domains (Martin Povišer) - arm64: dts: apple: t8112-j473: Use dcpext for HDMI out (Janne Grunau) - arm64: dts: apple: j474s/j475c: Use dcpext0 for HDMI out (Janne Grunau) - arm64: dts: apple: Fill device node for dp2hdmi on Macbook Pros (Janne Grunau) - arm64: dts: apple: t6022-{j180,j475}: Enable dcpext0/dptx-phy/dp2hdmi (Janne Grunau) - arm64: dts: apple: t6020-j474,t6021-j475: Enable dcp/dptx-phy/dp2hdmi (Janne Grunau) - arm64: dts: apple: t8112-j473: Enable dcp/dptx-phy/dp2hdmi (Janne Grunau) - arm64: dts: apple: t602x: Add device nodes for atc DP crossbar (Janne Grunau) - arm64: dts: apple: t600x: Add device nodes for atc DP crossbar (Janne Grunau) - arm64: dts: apple: t602x: Add lpdptx-phy node (Janne Grunau) - arm64: dts: apple: t8112: Add dptx-phy node (Janne Grunau) - arm64: dts: apple: t602x: Add t6020 dispext device nodes (Janne Grunau) - arm64: dts: apple: t600x: Add t6000 dispext device nodes (Janne Grunau) - arm64: dts: apple: t8112: Add dcpext/dispext0 nodes (Janne Grunau) - arm64: dts: apple: t8103: Add dcpext/dispext0 nodes (Janne Grunau) - arm64: dts: apple: t602x: Add "apple,min-state" to ps_dispextN_cpu0 (Janne Grunau) - arm64: dts: apple: t600x: Add "apple,min-state" to ps_dispextN_cpu0 (Janne Grunau) - arm64: dts: apple: t8112: Switch to apple,dma-range (Janne Grunau) - arm64: dts: apple: t8103: Switch to apple,dma-range (Janne Grunau) - arm64: dts: apple: t600x: Switch to apple,dma-range (Janne Grunau) - arm64: dts: apple: Disable ps_isp_sys unless it is used (Janne Grunau) - arm64: dts: apple: add opp-microwatt to t8103/t600x (James Calligeros) - arm64: dts: apple: j313: Model SDZ GPIO as a regulator (Hector Martin) - arm64: dts: apple: j293: Model SDZ GPIO as a regulator (Hector Martin) - arm64: dts: apple: describe shared SDZ GPIO for tas2764 (James Calligeros) - arm64: dts: apple: j493: Enable speakers (Hector Martin) - arm64: dts: apple: j313: Enable speakers (Hector Martin) - arm64: dts: apple: j293: Enable speakers (Hector Martin) - arm64: dts: apple: j375 & friends: Enable speakers (Hector Martin) - arm64: dts: apple: t600x-j314-j316: Set sound compatibles per device (Hector Martin) - arm64: dts: apple: j413: Model SDZ GPIO as a regulator (Hector Martin) - arm64: dts: apple: j493: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j415: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j413: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j313: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j293: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j375: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j415: Enable speakers (Hector Martin) - arm64: dts: apple: j413: Enable speakers (Hector Martin) - arm64: dts: apple: j314/j316: Enable speakers (Hector Martin) - arm64: dts: apple: t8103-j313: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t8103-j293: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t8112-j493: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t8112-j473: Add I/VMON slots to amp (Hector Martin) - arm64: dts: apple: t8112-j415: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t8112-j413: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t600x-j180d: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t600x-j375: Add I/VMON slots to amp (Hector Martin) - arm64: dts: apple: t8112: Mark MCA power states as externally-clocked (Hector Martin) - arm64: dts: apple: t8103: Mark MCA power states as externally-clocked (Hector Martin) - arm64: dts: apple: t602x: Mark MCA power states as externally-clocked (Hector Martin) - arm64: dts: apple: t600x: Mark MCA power states as externally-clocked (Hector Martin) - arm64: dts: apple: t600x-j314-j316: Zero out unused speaker sense slots (Martin Povišer) - arm64: dts: apple: t600x-j314-j316: Add speaker I/V sense slots (Martin Povišer) - arm64: dts: apple: t8103-j274: Add speaker I/V sense slots (Martin Povišer) - arm64: dts: apple: imx558: Add downscaled resolution presets (Hector Martin) - arm64: dts: apple: imx248: Add scaled and cropped presets (Janne Grunau) - arm64: dts: ISP platform configs (Asahi Lina) - arm64: dts: apple: t602x: Add ISP nodes (Asahi Lina) - arm64: dts: apple: t8112: Add ISP nodes (Hector Martin) - arm64: dts: apple: t6000: Add ISP nodes (Eileen Yoon) - arm64: dts: apple: t8103: Add ISP nodes (Eileen Yoon) - arm64: dts: apple: t8112: Add nvram alias (Hector Martin) - arm64: dts: apple: t8103: Add nvram alias (Hector Martin) - arm64: dts: apple: t6022-j180.dtsi: Add spi nor flash and nvram partition (Janne Grunau) - arm64: dts: apple: t600x-j375.dtsi: Add spi nor flash and nvram partition (Janne Grunau) - arm64: dts: apple: t8112: add opp-microwatt props to avalanche/blizzard (James Calligeros) - arm64: dts: apple: t6020x: Mark dptx_phy_ps only on laptops always-on (Janne Grunau) - arm64: dts: apple: t8112-j473: Add dptx-phy power-domain (Janne Grunau) - arm64: dts: apple: t602x: Add initial Mac Studio (2023) device trees (Janne Grunau) - arm64: dts: apple: t6020-j474s: Disable dcp until lpdpphy is supported (Janne Grunau) - arm64: dts: apple: t6022: Disable dcp thouroughly (Janne Grunau) - arm64: dts: apple: Share USB-C port node on t6022 devices (Janne Grunau) - arm64: dts: apple: t8112-j473: Set GPU base pstate (Asahi Lina) - arm64: dts: apple: Add devicetree for Macbook Air (15-inch, M2, 2023) (Janne Grunau) - arm64: dts: apple: t8112: Add touchbar digitizer node (Janne Grunau) - arm64: dts: apple: t6022: Add APCIE-GE nodes (Hector Martin) - arm64: dts: apple: Add j180d (Mac Pro 2023) device tree (Hector Martin) - arm64: dts: apple: Add initial t6022 support (Hector Martin) - arm64: dts: apple: t600x-j375.dtsi: Add missing etherhet0 alias (Hector Martin) - arm64: dts: apple: Add T602x GPU node (Asahi Lina) - arm64: dts: apple: t8112: Enable turbo CPU p-states (Hector Martin) - arm64: dts: apple: t8103: Enable turbo CPU p-states (Hector Martin) - arm64: dts: apple: t600x: Enable turbo CPU p-states (Hector Martin) - arm64: dts: apple: Make ps_msg always-on (Hector Martin) - arm64: dts: apple: t600x: Remove obsolete comment in ans2 power domain (Hector Martin) - arm64: dts: apple: Add pmgr-misc nodes to t60xx (Hector Martin) - DO NOT SUBMIT: arm64: dts: apple: t6020-j474s: Add unused PCIe port01 (Janne Grunau) - arm64: dts: apple: Add identity dma-ranges mapping (Hector Martin) - arm64: dts: apple: Add MTP nodes to t6020x (Hector Martin) - arm64: dts: apple: Add initial t602x device trees (Hector Martin) - arm64: dts: apple: Fix t600x mca IRQs (Hector Martin) - arm64: dts: apple: Add keyboard alias & layout props for t8112 laptops (Hector Martin) - arm64: dts: apple: j314/j316: Disable ATC3_USB_AON power domain (Hector Martin) - arm64: dts: apple: t8112: Add "ps_disp0_cpu0" as resets for dcp (Janne Grunau) - arm64: dts: apple: t8103: Add "ps_disp0_cpu0" as resets for dcp (Janne Grunau) - arm64: dts: apple: t600x: Add "ps_disp0_cpu0" as resets for dcp (Janne Grunau) - arm64: dts: apple: t8103: Add missing ps_pmp dependency to ps_gfx (Janne Grunau) - arm64: dts: apple: t8112: Add DCP power domain to missing devices (Hector Martin) - arm64: dts: apple: t8103: Add DCP power domain to missing devices (Hector Martin) - arm64: dts: apple: t600x: Add DCP power domain to missing devices (Hector Martin) - arm64: dts: apple: Add GPU firmware versions to t8113/t600x (Asahi Lina) - arm64: dts: apple: Add GPU nodes to T8112 (Asahi Lina) - arm64: dts: apple: Add no-map to GPU reserved-memory nodes (Asahi Lina) - arm64: dts: t8103: Add GPU leak coefficients (Asahi Lina) - arm64: dts: Add t600x GPU nodes (Asahi Lina) - arm64: dts: Add power data for t8103 (Asahi Lina) - arm64: dts: Add GPU performance data to t8103.dts (Asahi Lina) - arm64: dts: apple: t8103*: Add GPU nodes (Asahi Lina) - scripts/dtc: Add support for floating-point literals (Asahi Lina) - arm64: dts: apple: t8112: Add dcp/disp0 nodes (Janne Grunau) - arm64: dts: apple: t8112: Add ATCPHY nodes (Janne Grunau) - arm64: dts: apple: t8112: Add eFuses node (Janne Grunau) - arch: arm64: apple: Add dcp panel node for t600x based laptops (Janne Grunau) - arch: arm64: apple: Add dcp panel node for t8103 based laptops and imacs (Janne Grunau) - arch: arm64: dts: apple: t600x: Add ATCPHY nodes (R) - arch: arm64: dts: apple: t6000: Add eFuses node (R) - arm64: dts: apple: t8103: Add ATCPHY node (Sven Peter) - arm64: dts: apple: t8103: Add eFuses node (Sven Peter) - arch: arm64: apple: t600x: Add connector type property for DCP* (Janne Grunau) - arch: arm64: apple: t8103: Add connector type property for DCP* (Janne Grunau) - arch: arm64: apple: t600x: Add display controller related device tree nodes (Janne Grunau) - arch: arm64: apple: Add display controller related device tree nodes (Hector Martin) - arch: arm64: apple: t600x: Mark USB and PCIe as "dma-coherent" (Janne Grunau) - arch: arm64: apple: Add missing power state deps for display (Janne Grunau) - arm64: dts: apple: t6001-j375c: Add USB3 hub GPIO initialization (Hector Martin) - arm64: dts: apple: Drop 'integrated audio' from sound models (Martin Povišer) - arm64: dts: apple: t600x-jxxx: Put in audio nodes (Martin Povišer) - arm64: dts: apple: t8103*: Put in audio nodes (Martin Povišer) - arm64: dts: apple: t600x: Add bluetooth device trees (Hector Martin) - arm64: dts: apple: Add PCI power enable GPIOs (Hector Martin) - arm64: dts: apple: Add WiFi module and antenna properties (Hector Martin) - arm64: dts: apple: t600x: Add dwc3 nodes (Janne Grunau) - arm64: dts: apple: j31[46]: Add keyboard nodes (Janne Grunau) - arm64: dts: apple: Add PMU NVMEM and SMC RTC/reboot nodes (Hector Martin) - arm64: dts: apple: Add SMC node to t600x devicetrees (Hector Martin) - arm64: dts: apple: Keep PCIe power domain on (Hector Martin) - arm64: dts: apple: Mark ATC USB AON domains as always-on (Hector Martin) - arm64: dts: apple: Add PMU NVMEM and SMC RTC/reboot nodes (Hector Martin) - arm64: dts: apple: Add SMC node to t8103/t6001 devicetrees (Hector Martin) - arm64: dts: apple: Add PCI power enable GPIOs (Hector Martin) - arm64: dts: apple: t8103: Add spi3 keyboard node (Janne Grunau) - arm64: dts: apple: t8103: Add dwc3 nodes (Hector Martin) - arm64: dts: apple: t8112: Add mtp device nodes for j413/j493 (Janne Grunau) - arm64: dts: apple: t8112: Add dwc3 nodes (Janne Grunau) - arm64: dts: apple: t8112*: Put in audio nodes (Martin Povišer) - arm64: dts: apple: t8112: Add SMC node to devicetree (Hector Martin) - arm64: dts: apple: t8112: Add PMU NVMEM and SMC RTC/reboot nodes (Hector Martin) - arm64: dts: apple: t8112: Add wlan/bt PCIe device nodes (Janne Grunau) - arm64: dts: apple: t8112: Remove always-on from the PMP node (Hector Martin) - arm64: dts: apple: t8015: Add backlight nodes (Nick Chan) - arm64: dts: apple: t8010: Add backlight nodes (Nick Chan) - arm64: dts: apple: s800-0-3: Add backlight nodes (Nick Chan) - arm64: dts: apple: t7000: Add backlight nodes (Nick Chan) - arm64: dts: apple: s5l8960x: Add backlight nodes (Nick Chan) - arm64: dts: apple: Add touchbar screen nodes (Sasha Finkelstein) - arm64: dts: apple: Add touchbar digitizer nodes (Sasha Finkelstein) - arm64: dts: apple: Add SPI NOR nvram partition to all devices (Janne Grunau) - arm64: dts: apple: t600x: Add spi controller nodes (Janne Grunau) - arm64: dts: apple: t8112: Add spi controller nodes (Janne Grunau) - arm64: dts: apple: t8103: Add spi controller nodes (Janne Grunau) - arm64: dts: apple: t8103: Fix spi4 power domain sort order (Hector Martin) - arm64: dts: apple: t7000: Add missing CPU p-state 7 for J96 and J97 (Nick Chan) - arm64: dts: apple: t8015: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: t8012: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: t8011: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: t8010: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: s8001: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: Add cpufreq nodes for S8000/S8003 (Nick Chan) - arm64: dts: apple: t7001: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: t7000: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: s5l8960x: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: t8015: Add PMGR nodes (Nick Chan) - arm64: dts: apple: t8012: Add PMGR nodes (Nick Chan) - arm64: dts: apple: t8011: Add PMGR nodes (Nick Chan) - arm64: dts: apple: t8010: Add PMGR nodes (Nick Chan) - arm64: dts: apple: s8001: Add PMGR nodes (Nick Chan) - arm64: dts: apple: s800-0-3: Add PMGR nodes (Nick Chan) - arm64: dts: apple: t7001: Add PMGR node (Nick Chan) - arm64: dts: apple: t7000: Add PMGR node (Nick Chan) - arm64: dts: apple: s5l8960x: Add PMGR node (Nick Chan) - dt-bindings: arm: apple: apple,pmgr-pwrstate: Add A7-A11, T2 compatibles (Nick Chan) - dt-bindings: arm: apple: apple,pmgr: Add A7-A11, T2 compatibles (Nick Chan) - arm64: dts: apple: Add T2 devices (Nick Chan) - dt-bindings: arm: apple: Add T2 devices (Nick Chan) - arm64: dts: apple: Split s8000/s8003 SoC DTS files (Nick Chan) - soc: apple: rtkit: Pass the crashlog to the crashed() callback (Asahi Lina)- drm/xe/display: Re-use display vmas when possible (Maarten Lankhorst) [2367813] - Revert "loop: Add sanity check for read/write_iter" (Justin M. Forbes) - Fix up typo in release_targets (Justin M. Forbes) - Linux v6.14.8- Turn on MITIGATION_ITS for RHEL configs (Justin M. Forbes) - Add bug to Bugsfixed for 6.14.7 (Justin M. Forbes) - powerpc/bpf: fix JIT code size calculation of bpf trampoline (Hari Bathini) - Set MITIGATION_ITS for Fedora (Justin M. Forbes) - Fedora 40 is EOL (Justin M. Forbes) - Linux v6.14.7- platform/x86/intel/pmc: Add Arrow Lake U/H support to intel_pmc_core driver (Xi Pardee) - platform/x86:intel/pmc: Move arch specific action to init function (Xi Pardee) - platform/x86/intel/pmc: Remove simple init functions (Xi Pardee) - platform/x86:intel/pmc: Create generic_core_init() for all platforms (Xi Pardee) - platform/x86/intel/pmc: Remove duplicate enum (Xi Pardee) - platform/x86:intel/pmc: Make tgl_core_generic_init() static (Xi Pardee) - redhat/configs: Add configs for new ov02c10 and ov02e10 drivers (Hans de Goede) - media: i2c: Add Omnivision OV02C10 sensor driver (Heimir Thor Sverrisson) - media: i2c: ov02e10: add OV02E10 image sensor driver (Jingjing Xiong) - platform/x86: int3472: Debug log when remapping pins (Hans de Goede) - platform/x86: int3472: Add handshake pin support (Hans de Goede) - platform/x86: int3472: Prepare for registering more than 1 GPIO regulator (Hans de Goede) - platform/x86: int3472: Avoid GPIO regulator spikes (Hans de Goede) - platform/x86: int3472: Make regulator supply name configurable (Hans de Goede) - platform/x86: int3472: Rework AVDD second sensor quirk handling (Hans de Goede) - platform/x86: int3472: Drop unused gpio field from struct int3472_gpio_regulator (Hans de Goede) - platform/x86: int3472: Stop setting a supply-name for GPIO regulators (Hans de Goede) - platform/x86: int3472: Add skl_int3472_register_clock() helper (Hans de Goede) - platform/x86: int3472: Call "func" "con_id" instead (Sakari Ailus) - Turn on ACPI_DEBUG for Fedora (Justin M. Forbes) - Linux v6.14.6- Fix up configs for 6.14.5 merge (Justin M. Forbes) - Turn off CONFIG_PCI_REALLOC_ENABLE_AUTO for Fedora (Justin M. Forbes) - Linux v6.14.5- Add F41 and F40 to release targets (Justin M. Forbes) - Linux v6.14.4- New configs for stable update (Justin M. Forbes) - Enable FunctionFS on aarch64 + x86 (Sam Day) - Turn on USB Gadget for Fedora x86 (Justin M. Forbes) - Linux v6.14.3- Config update for 6.14.2 (Justin M. Forbes) - Linux v6.14.2- Config updates for 6.14.1 (Justin M. Forbes) - redhat/kernel.spec: list python3-wheel explicitly for Fedora<42 (Jan Stancek) - serial: 8250_dma: terminate correct DMA in tx_dma_flush() (John Keeping) - serial: stm32: do not deassert RS485 RTS GPIO prematurely (Cheick Traore) - perf tools: Fix up some comments and code to properly use the event_source bus (Greg Kroah-Hartman) - memstick: rtsx_usb_ms: Fix slab-use-after-free in rtsx_usb_ms_drv_remove (Luo Qiu) - usb: xhci: Apply the link chain quirk on NEC isoc endpoints (Michal Pecio) - usb: xhci: Don't skip on Stopped - Length Invalid (Michal Pecio) - net: usb: usbnet: restore usb%d name exception for local mac addresses (Dominique Martinet) - net: usb: qmi_wwan: add Telit Cinterion FE990B composition (Fabio Porcedda) - net: usb: qmi_wwan: add Telit Cinterion FN990B composition (Fabio Porcedda) - tty: serial: fsl_lpuart: disable transmitter before changing RS485 related registers (Sherry Sun) - tty: serial: 8250: Add Brainboxes XC devices (Cameron Williams) - tty: serial: 8250: Add some more device IDs (Cameron Williams) - counter: microchip-tcb-capture: Fix undefined counter channel state on probe (William Breathitt Gray) - counter: stm32-lptimer-cnt: fix error handling when enabling (Fabrice Gasnier) - ALSA: hda/realtek: Bass speaker fixup for ASUS UM5606KA (Andres Traumann) - ALSA: hda/realtek: Support mute LED on HP Laptop 15s-du3xxx (Dhruv Deshpande) - netfilter: socket: Lookup orig tuple for IPv6 SNAT (Maxim Mikityanskiy) - cgroup/rstat: Fix forceidle time in cpu.stat (Abel Wu) - atm: Fix NULL pointer dereference (Minjoong Kim) - HID: hid-plantronics: Add mic mute mapping and generalize quirks (Terry Junge) - ALSA: usb-audio: Add quirk for Plantronics headsets to fix control names (Terry Junge) - Documentation/powerpc/fadump: add additional parameter feature details (Mamatha Inamdar) [RHEL-70827] - powerpc: increase MIN RMA size for CAS negotiation (Mamatha Inamdar) [RHEL-70827] - powerpc/fadump: fix additional param memory reservation for HASH MMU (Mamatha Inamdar) [RHEL-70827] - powerpc: export MIN RMA size (Mamatha Inamdar) [RHEL-70827] - fedora: arm64: move some TI drivers to modular (Peter Robinson) - fedora: minor cleanups for 6.14 (Peter Robinson) - Initial setup for stable Fedora releases (Justin M. Forbes) - powerpc64/ftrace: fix module loading without patchable function entries (Anthony Iliopoulos) - x86/insn_decoder_test: allow longer symbol-names (David Rheinsberg) - apply -Wno-error=unterminated-string-initialization temporarily (Thorsten Leemhuis) - Linux v6.14.1- Reset RHEL_RELEASE for 6.15 cycle (Justin M. Forbes)- arm64: cleanup and de-dupe erratum (Peter Robinson) - arm64: cleanup and de-dupe configs (Peter Robinson) - cleanup: x86: cleanup some x86_32 leftovers (Peter Robinson) - all: cleanup CAN_ROCKCHIP_CANFD (Peter Robinson) - aarch64: Options required for UEFI HTTP boot on SystemReady-DT (Peter Robinson) - common: Move ZONE_DEVICE to generic (Peter Robinson) - common: Cleanup BTT (Peter Robinson) - cleanup: move DEV_DAX_PMEM to common/generic (Peter Robinson) - generic: cleanup the NVDIMM options (Peter Robinson) - cleanup: move OF_PMEM to common/generic (Peter Robinson) - cleanup: Remove DEV_DAX_PMEM_COMPAT option (Peter Robinson) - mei: vsc: Fix fortify-panic caused by invalid counted_by() use (Hans de Goede) - Linux v6.14.0- Linux v6.14.0-0.rc7.586de92313fc- Consolidate configs into common for 6.14 (Justin M. Forbes) - Turn VIRTIO_BLK and VIRTIO_CONSOLE inline for Fedora (Justin M. Forbes) - Linux v6.14.0-0.rc7.88d324e69ea9- Linux v6.14.0-0.rc7.b3ee1e460951- Linux v6.14.0-0.rc7.a7f2e10ecd8f- redhat: configs: fedora: enable CONFIG_I2C_HID_OF=m on x86 (Hans de Goede) - redhat: move dist-relase-check behind new variable (Jan Stancek) - Set last minute config item for 6.14 for Fedora (Justin M. Forbes) - Linux v6.14.0-0.rc7.81e4f8d68c66- redhat/configs: automotive: Disable CONFIG_USERFAULTFD config (Dorinda Bassey) - Revert "be2iscsi: remove unsupported device IDs" (Scott Weaver) - Revert "megaraid_sas: remove deprecated pci-ids" (Scott Weaver) - Revert "[scsi] megaraid_sas: re-add certain pci-ids" (Scott Weaver) - media: ov08x40: Extend sleep after reset to 5 ms (Hans de Goede) - media: ov08x40: Log chip ID when identifying the chip (Hans de Goede) - media: ov08x40: Fix value of reset GPIO when requesting it (Hans de Goede) - redhat/configs: automotive: Disable VLAN_8021Q_GVRP config (Dorinda Bassey) - redhat/configs: automotive: Disable DCB and MPLS configs (Dorinda Bassey) - redhat/configs: automotive: Disable IEEE 802.15.4 config (Dorinda Bassey) - redhat/configs: automotive: Disable various network classification features (Dorinda Bassey) - redhat/configs: automotive: Disable the SMBFS file system (Dorinda Bassey) - redhat/configs: automotive: Disable Myricom network adapters (Dorinda Bassey) - redhat/configs: automotive: Disable USB4 Ethernet config (Dorinda Bassey) - redhat/configs: automotive: Disable the Mellanox SwitchX core driver (Dorinda Bassey) - redhat/configs: automotive: Disable network storage related protocols (Dorinda Bassey) - redhat/configs: automotive: Disable lightweight tunneling with BPF (Dorinda Bassey) - redhat/configs: automotive: Disable RADOS block device configs (Dorinda Bassey) - redhat/configs: automotive: Disable switchdev driver framework (Dorinda Bassey) - redhat/configs: automotive: Disable network packet generator (Dorinda Bassey) - redhat/configs: automotive: Disable NET_CLS_ACT and PSAMPLE configs (Dorinda Bassey) - redhat/configs: automotive: Disable BPF STREAM_PARSER (Dorinda Bassey) - redhat/configs: automotive: Disable Open vSwitch and NET_NSH configs (Dorinda Bassey) - redhat/configs: automotive: Disable IP Virtual Server configs (Dorinda Bassey) - redhat/configs: automotive: Disable IP set support (Dorinda Bassey) - redhat/configs: automotive: Disable NetLabel subsystem support (Dorinda Bassey) - redhat/configs: automotive: Disable TLS Protocol (Dorinda Bassey) - redhat/configs: automotive: Disable Advanced TCP Congestion Control (Dorinda Bassey) - redhat/configs: automotive: Disable XDP Socket Protocol (Dorinda Bassey) - redhat/configs: delete CONFIG_USB_ONBOARD_HUB and use CONFIG_USB_ONBOARD_DEV instead (Desnes Nunes) - redhat: check release commit is present for dist-{release-tag,git} (Jan Stancek) - Revert "qla4xxx: Remove deprecated PCI IDs from RHEL 8" (Scott Weaver) - Re-enable vxcan (CONFIG_CAN_VXCAN) for automotive (Radu Rendec) - Linux v6.14.0-0.rc7.76b6905c11fd- Linux v6.14.0-0.rc7- Linux v6.14.0-0.rc6.cb82ca153949- Linux v6.14.0-0.rc6.3571e8b091f4- Linux v6.14.0-0.rc6.695caca9345a- Revert "mpt*: remove certain deprecated pci-ids" (Scott Weaver) - Turn on CONFIG_PACKING for RHEL (Justin M. Forbes) - main.c: fix initcall blacklisted (Tomas Henzl) - redhat/configs: automotive: Disable IPsec Protocols and XFRM (Dorinda Bassey) - Linux v6.14.0-0.rc6.b7f94fcf5546- redhat: Update CONFIG_STRICT_DEVMEM settings (enable it on s390x) (Thomas Huth) - redhat: Consolidate CONFIG_VIRTIO_MEM and enable it also for s390x (Thomas Huth) - Remove no longer necessary pending entry (Justin M. Forbes) - Linux v6.14.0-0.rc6.0fed89a961ea- Fedora configs for 6.14 (Justin M. Forbes) - Linux v6.14.0-0.rc6.4d872d51bc9d- redhat/configs: Disable rest of the CONFIG_PKEY_ options on s390 (Mete Durlu) [RHEL-78341] - Linux v6.14.0-0.rc6- Fix up some debug module loading issues due to BTF mismatch (Justin M. Forbes) - Linux v6.14.0-0.rc5.2a520073e74f- Revert "redhat/configs: automotive: disable CONFIG_AIO" (Davide Caratti) - redhat/configs: automotive disable ARCH_TEGRA_241_SOC (Eric Chanudet) - rhel_files: ensure all qdiscs are in modules-core (Davide Caratti) [RHEL-79818] - redhat/configs: automotive: Disable MRP/8021Q_MVRP Protocol (Dorinda Bassey) - Linux v6.14.0-0.rc5.00a7d39898c8- Linux v6.14.0-0.rc5.848e07631744- redhat/configs: enable CONFIG_ARM_SMMU_MMU_500_CPRE_ERRATA (Jerry Snitselaar) - redhat/configs: enable CONFIG_ARM_SMMU_V3_IOMMUFD (Jerry Snitselaar) - redhat: configs: remove CONFIG_DMA_API_DEBUG_SG (Kate Hsuan) - Linux v6.14.0-0.rc5.48a5eed9ad58- Linux v6.14.0-0.rc5.99fa936e8e4f- Linux v6.14.0-0.rc5- Linux v6.14.0-0.rc4.ece144f151ac- Linux v6.14.0-0.rc4.03d38806a902- Linux v6.14.0-0.rc4.76544811c850- kernel.spec: add missing tools-libs on s390x (Jan Stancek) - arch/x86/kernel/setup.c: fix rh_check_supported (Tomas Henzl) - kernel.spec: add minimum version of setuptools for ynl (Jan Stancek) - Linux v6.14.0-0.rc4.dd83757f6e68- Linux v6.14.0-0.rc4.ac9c34d1e45a- Revert "Merge: redhat/configs: automotive: Disable POSIX_MQUEUE config (Dorinda Bassey) - redhat/configs: enable in kernel compression/decompression of compressed modules (Herton R. Krzesinski) - redhat: change compression flags for xz (Herton R. Krzesinski) - redhat/configs: automotive: Turn off ACPI Processor package for aarch64 (Enric Balletbo i Serra) - redhat/configs: automotive: Disable L2TP Protocol (Dorinda Bassey) - redhat/configs: automotive: Disable TIPC Protocol (Dorinda Bassey)- redhat/configs: Enable Mediatek Bluetooth USB drivers (Bastien Nocera) - redhat/configs: Disable CONFIG_PKEY for zfcpdump configs (Mete Durlu) [RHEL-78341] - Linux v6.14.0-0.rc4- Linux v6.14.0-0.rc3.27102b38b8ca- Linux v6.14.0-0.rc3.ff202c5028a1- Linux v6.14.0-0.rc3.334426094588- Linux v6.14.0-0.rc3.87a132e73910- redhat/configs: automotive: disable VFIO_PLATFORM (Eric Chanudet) - Revert "Merge: redhat/configs: automotive: Disable SYSIPC config" (Dorinda Bassey) - redhat/configs: Enable CONFIG_KASAN_INLINE for RT debug kernel (Waiman Long) - redhat/configs: Move CONFIG_PROVE_RAW_LOCK_NESTING to common/debug (Waiman Long) - redhat/configs: Move all the lock debugging Kconfig's to common (Waiman Long) - redhat/configs: Enable CONFIG_BLK_CGROUP_PUNT_BIO for RHEL (Neal Gompa) [RHEL-79711] - Linux v6.14.0-0.rc3.6537cfb395f3- fedora: pending: drop USB_ONBOARD_DEV_USB5744 (Peter Robinson) - Linux v6.14.0-0.rc3.2408a807bfc3- efi,lockdown: fix kernel lockdown on Secure Boot (Ondrej Mosnacek) {CVE-2025-1272} - Linux v6.14.0-0.rc3- Linux v6.14.0-0.rc2.ad1b832bf1cf- fedora: Update vbox drivers (Peter Robinson) - Drop the s390x CONFIG_REGMAP from RHEL pending as upstream removed the dep (Justin M. Forbes) - Linux v6.14.0-0.rc2.7ff71e6d9239- fedora: arm64: enable RT5616 codec (Marcin Juszkiewicz) - Linux v6.14.0-0.rc2.128c8f96eb86- Revert "nvme: Return BLK_STS_TARGET if the DNR bit is set" (Benjamin Marzinski) - Revert "nvme: allow local retry and proper failover for REQ_FAILFAST_TRANSPORT" (Benjamin Marzinski) - Revert "nvme: decouple basic ANA log page re-read support from native multipathing" (Benjamin Marzinski) - Revert "nvme: nvme_mpath_init remove multipath check" (Benjamin Marzinski) - redhat/configs: automotive: Disable CONFIG_FS_DAX config (Dorinda Bassey) - config: update CONFIG_LSM to match upstream (Ryan Sullivan) - redhat: configs: enable CONFIG_INTEL_ISH_FIRMWARE_DOWNLOADER for RHEL (David Arcari) - redhat/Makefile: Add help text for target dist-dump-variables (Eder Zulian) - media: ov08x40: Don't log ov08x40_check_hwcfg() errors twice (Hans de Goede) - media: ov08x40: Add missing '\n' to ov08x40_check_hwcfg() error messages (Hans de Goede) - media: ov08x40: Add missing ov08x40_identify_module() call on stream-start (Hans de Goede) - media: ov08x40: Improve ov08x40_[read|write]_reg() error returns (Hans de Goede) - media: ov08x40: Improve ov08x40_identify_module() error logging (Hans de Goede) - media: ov08x40: Move ov08x40_identify_module() function up (Hans de Goede) - media: ov08x40: Get clock on ACPI platforms too (Hans de Goede) - media: ov08x40: Get reset GPIO and regulators on ACPI platforms too (Hans de Goede) - media: ov08x40: Move fwnode_graph_get_next_endpoint() call up (Hans de Goede) - media: ov08x40: Properly turn sensor on/off when runtime-suspended (Hans de Goede) - redhat: update self-test-data for new default RHJOBS value (Patrick Talbert) - set a more reasonable default for number of jobs (Thorsten Leemhuis) - Linux v6.14.0-0.rc2.4dc1d1bec898- redhat: automotive: define CONFIG_RH_AUTOMOTIVE (Scott Weaver) - redhat/configs: disable CONFIG_TCP_AO on RHEL (Sabrina Dubroca) - Linux v6.14.0-0.rc2.09fbf3d50205- Linux v6.14.0-0.rc2.febbc555cf0f- Linux v6.14.0-0.rc2- Linux v6.14.0-0.rc1.9946eaf552b1- redhat/configs: amend USB_ONBOARD_DEV_USB5744 (Eric Chanudet) - redhat/configs: automotive: Disable SYSIPC and MQUEUE configs (Dorinda Bassey) - redhat: kernel.spec: add ynl to kernel-tools (Jan Stancek) - Linux v6.14.0-0.rc1.8f6629c004b1- fedora: enable USB device USB5744 (Peter Robinson) - Linux v6.14.0-0.rc1.bb066fe812d6- Linux v6.14.0-0.rc1.92514ef226f5- rhel: enable FW_CACHE on RHEL (Dave Airlie) - redhat/configs: automotive: Disable the SCTP Protocol (Dorinda Bassey) - Linux v6.14.0-0.rc1.5c8c229261f1- Linux v6.14.0-0.rc1.0de63bb7d919- redhat: generalize rule for kunit and test kmod placement (Jan Stancek) - Linux v6.14.0-0.rc1- Linux v6.14.0-0.rc0.a86bf2283d2c- Move CONFIG_PCI_REALLOC_ENABLE_AUTO out of common as they have diverged (Justin M. Forbes) - fedora: arm64: enable Silicon Mitus SM5502 Extcon driver (Sam Day) - fedora: arm64: enable Richtek RT5033 MFD+charger+regulator modules (Sam Day) - configs/fedora: Enable CONFIG_PCI_REALLOC_ENABLE_AUTO (Yanko Kaneti) - Enable CONFIG_INTEL_MEI_PXP and CONFIG_DRM_I915_PXP on rhel (Jocelyn Falempe) - Enable Intel Xe Graphics (Mika Penttilä) - Linux v6.14.0-0.rc0.60c828cf80c0- Turn on CONFIG_DRM_ACCEL_AMDXDNA for Fedora (Justin M. Forbes) - Linux v6.14.0-0.rc0.69e858e0b8b2- redhat/configs: disable CONFIG_AF_UNIX_OOB on RHEL (Marcelo Ricardo Leitner) - redhat/configs: automotive: Disable wireless network and it's dependencies (Dorinda Bassey) - Linux v6.14.0-0.rc0.72deda0abee6- Linux v6.14.0-0.rc0.05dbaf8dd8bf- redhat/kernel.spec: work around find-debuginfo aborting cross builds (Jan Stancek) - redhat/configs: Default to batched invalidation on s390 (Jerry Snitselaar) - Linux v6.14.0-0.rc0.6d61a53dd6f5- Linux v6.14.0-0.rc0.9c5968db9e62- redhat/configs: automotive: set CONFIG_TIMEOUT_PANIC (Enric Balletbo i Serra) - drop %{_datadir}/perf-core/* from kernel.spec (Thorsten Leemhuis) - put new misc_minor_kunit in modules-internal (Thorsten Leemhuis) - put new cirrus kunit tests in modules-internal (Thorsten Leemhuis) - redhat/configs: enable iBFT parsing on aarch64 (Chris Leech) - redhat: kernel.spec: fix build with merged-sbin (Zbigniew Jędrzejewski-Szmek)- Fix up CONFIG_REGMAP mismatch (Scott Weaver) - Linux v6.14.0-0.rc0.aa22f4da2a46- redhat: fix modules.order target (Scott Weaver) - Linux v6.14.0-0.rc0.bc8198dc7ebc- Fix up CONFIG_CRC_T10DIF_IMPL_GENERIC mismatch (Justin M. Forbes) - Fix mismatches for 6.13 merge window (Justin M. Forbes) - Linux v6.14.0-0.rc0.d0d106a2bd21- Reset rhelver and trim changelog for 6.14 (Justin M. Forbes) - Linux v6.14.0-0.rc0.c4b9570cfb63- Turn off CONFIG_ARM_TIMER_SP804 for automotive (Justin M. Forbes) - Set ARM_TIMER_SP804 (Justin M. Forbes) - redhat/configs: enable addtional sa8775 related Kconfigs (Brian Masney) - redhat: Add rustfmt to deps (Peter Robinson) - redhat/configs: Disable deprecated CONFIG_LCS option on s390 (Mete Durlu) [RHEL-68296] - redhat/configs: make modular/disable NFS support (Dorinda Bassey) - redhat/configs: Disable unsafe queuing disciplines (Dorinda Bassey) - configs: move pending RT configs into rhel/rt/generic (Clark Williams) - Turn on PROVE_RAW_LOCK_NESTING for RHEL debug builds (Justin M. Forbes) - redhat/Makefile: Fix long dist-full-help execution time (Prarit Bhargava) - redhat/self-test: Update data to add HELP_TYPES variable (Prarit Bhargava) - redhat/Makefile: Add new dist-help functionality (Prarit Bhargava) - Makefile: Do not output LOCALVERSION message for help commands (Prarit Bhargava) - Fedora 6.13 configs part 2 (Justin M. Forbes) - Fedora 6.13 configs part 1 (Justin M. Forbes) - redhat/configs: enable CONFIG_VFAT_FS as a module (Dorinda Bassey) - redhat: create 'debug' addon for UKI (Li Tian) - kernel.spec: Build cpupower on riscv64 (Yanko Kaneti) - RHEL: Set correct config option for CRYPTO_HMAC_S390 (Mete Durlu) [RHEL-24137] - redhat/kernel.spec: add iputils to the requires list for selftests-internal (Brian Masney) - redhat/kernel.spec.template: Require kernel-tools-libs in rtla (Tomas Glozar) - redhat: make kernel-debug-uki-virt installable without kernel-debug-core (Vitaly Kuznetsov) - redhat/configs: enable CONFIG_USB_XHCI_PCI_RENESAS on RHEL (Desnes Nunes) [RHEL-72093] - redhat/configs: Re-enable ZRAM backends and unify configuration (Neal Gompa) - redhat/configs: automotive: disable CONFIG_AIO (Davide Caratti) - redhat/configs: Re-enable CONFIG_INFINIBAND_VMWARE_PVRDMA (Vitaly Kuznetsov) - redhat/configs: PREEMPT_NOTIFIERS does not need to be explicitly listed (Michal Schmidt) - redhat/configs: delete all CONFIG_PREEMPT_*BEHAVIOUR (Michal Schmidt) - redhat/configs: automotive: disable CONFIG_NET_DROP_MONITOR (Davide Caratti) - redhat/configs: Enable the CS42L84 driver on Fedora (Neal Gompa) - generic: Remove and cleanups from staging 6.13 (Peter Robinson) - redhat: configs: Clean up DVB settings in RHEL (Kate Hsuan) - Move CONFIG_ARCH_TEGRA_241_SOC config/common so that it is enabled for RHEL as well as Fedora. Get rid of uneeded CONFIG_TEGRA241_CMDQV in configs/fedora while we're at it. (Mark Salter) - fedora: arm64: Enable the rockchip HDMI QP support (Peter Robinson) - crypto: rng - Fix extrng EFAULT handling (Herbert Xu) - redhat: configs: rhel: aarch64: Support NV Jetson MIPI camera (Kate Hsuan) - gitlab-ci: disable clang CI pipelines (Scott Weaver) - redhat/configs: Remove obsolete arch64/64k/CONFIG_FORCE_MAX_ZONEORDER (Waiman Long) - Fix up QCOM_EMAC config for Fedora (Justin M. Forbes) - redhat/configs: automotive: disable CONFIG_IO_URING (Ian Mullins) - redhat/kernel.spec.template: Link rtla against in-tree libcpupower (Tomas Glozar) - redhat: configs: enable INTEL_PLR_TPMI for RHEL (David Arcari) - configs: Enable CONFIG_NETKIT for RHEL (Toke Høiland-Jørgensen) - redhat: fix build/install targets in netfilter kselftest (Davide Caratti) - RHEL: disable the btt driver (Jeff Moyer) - redhat/configs: default to PREEMPT_LAZY on x86, riscv (Michal Schmidt) - redhat/configs: New config CONFIG_PREEMPT_LAZY (Michal Schmidt) - crypto: sig - Disable signing (Herbert Xu) - redhat/configs: enable SERIAL_AMBA_PL011 for automotive (Radu Rendec) - c10s: disable tests in CKI pipelines (Michael Hofmann) - redhat: Drop bpftool from kernel spec (Viktor Malik) - Better fixes for the fedora mismatch (Justin M. Forbes) - Mismatch fix ups for Fedora (Justin M. Forbes) - redhat/configs: Enable Intel Bluetooth PCIE drivers (Bastien Nocera) - One more pending to fix a mismatch (Justin M. Forbes) - redhat: fix RT PREEMPT configs for Fedora and RHEL (Clark Williams) - Pending fixes to avoid mismatch for 6.13 (Justin M. Forbes) - Reset changelog for 6.13 (Justin M. Forbes) - Reset RHEL_RELEASE for 6.13 (Justin M. Forbes) - redhat: Move perf_dlfilter.h from libperf-devel to perf (Akihiko Odaki) - Consolidate configs to common for 6.12 (Justin M. Forbes) - redhat/configs: cleanup CONFIG_DEV_DAX (David Hildenbrand) - redhat/configs: cleanup CONFIG_TRANSPARENT_HUGEPAGE_MADVISE for Fedora (David Hildenbrand) - redhat/configs: cleanup CONFIG_TRANSPARENT_HUGEPAGE (David Hildenbrand) - redhat/configs: enable CONFIG_TRANSPARENT_HUGEPAGE on s390x in Fedora (David Hildenbrand) - redhat/configs: automotive: Enable j784s4evm am3359 tscadc configs (Joel Slebodnick) - redhat/configs: delete renamed CONFIG_MLX5_EN_MACSEC (Michal Schmidt) - rhel: disable DELL_RBU and cleanup related deps (Peter Robinson) - crypto: rng - Ensure stdrng is tested before user-space starts (Herbert Xu) - gitlab-ci: Add CKI_RETRIGGER_PIPELINE (Tales da Aparecida) - redhat: configs: disable the qla4xxx iSCSI driver (Chris Leech) [RHEL-1242] - Remove duplicated CONFIGs between automotive and RHEL (Julio Faracco) - redhat: update self-test data for addition of automotive (Scott Weaver) - gitlab-ci: enable automotive pipeline (Scott Weaver) - automotive: move pending configs to automotive/generic (Scott Weaver) - redhat/configs: change Renesas eMMC driver and dependencies to built-in (Radu Rendec) - redhat/configs: automotive: Remove automotive specific override CONFIG_OMAP2PLUS_MBOX By removing this automotive-specific override, the configuration will default to the common configuration (CONFIG_OMAP2PLUS_MBOX=m), which enables the driver as a module. (Martin McConnell) - Config enablement of the Renesas R-Car S4 SoC (Radu Rendec) [RHEL-44306] - redhat/configs: automotive: Enable USB_CDNS3_TI for TI platforms (Andrew Halaney) - redhat/configs: automotive: Enable j784s4evm SPI configs (Joel Slebodnick) - redhat/configs: automotive: Enable TPS6594 MFD (Joel Slebodnick) - redhat/configs: automotive: stop overriding CRYPTO_ECDH (Andrew Halaney) - redhat/configs: automotive: Enable PCI_J721E (Andrew Halaney) - redhat/configs: change some TI platform drivers to built-in (Enric Balletbo i Serra) - redhat/configs: automotive: Enable TI j784s4evm display dependencies (Andrew Halaney) - redhat/configs: automotive: match ark configs to cs9 main-automotive (Shawn Doherty) [RHEL-35995] - redhat/configs: automotive: Enable TI's watchdog driver (Andrew Halaney) - redhat/configs: automotive: Enable TI's UFS controller (Andrew Halaney) - redhat/configs: automotive: Enable networking on the J784S4EVM (Andrew Halaney) [RHEL-29245] - Disable unsupported kernel variants for automotive (Don Zickus) - Disable CONFIG_RTW88_22BU (Don Zickus) - redhat: Delete CONFIG_EFI_ZBOOT to use the common CONFIG (Julio Faracco) - redhat: Update automotive SPEC file with new standards (Julio Faracco) - redhat: Disable WERROR for automotive temporarily (Julio Faracco) - redhat: Update spec file with automotive macros (Julio Faracco) - redhat: Add automotive CONFIGs (Julio Faracco) - Fedora configs for 6.12 (Justin M. Forbes) - redhat/configs: Add CONFIG_CRYPTO_HMAC_S390 config (Mete Durlu) [RHEL-50799] - redhat: configs: common: generic: Clean up EM28XX that are masked behind CONFIG_VIDEO_EM28XX (Kate Hsuan) - redhat/configs: Update powerpc NR_CPUS config (Mamatha Inamdar) - redhat: use stricter rule for kunit.ko (Jan Stancek) - filtermod: fix clk kunit test and kunit location (Nico Pache) - redhat/configs: enable xr_serial on rhel (Desnes Nunes) - redhat/configs: enable ATH12K for rhel (Jose Ignacio Tornos Martinez) - redhat: configs: rhel: generic: x86: Enable IPU6 based MIPI cameras (Kate Hsuan) - os-build: enable CONFIG_SCHED_CLASS_EXT for RHEL (Phil Auld) - Fedora 6.12 configs part 1 (Justin M. Forbes) - redhat: set new gcov configs (Jan Stancek) - Don't ignore gitkeep files for ark-infra (Don Zickus) - redhat/kernel.spec: don't clear entire libdir when building tools (Jan Stancek) - redhat/configs: enable usbip for rhel (Jose Ignacio Tornos Martinez) - redhat: create 'crashkernel=' addons for UKI (Vitaly Kuznetsov) - redhat: avoid superfluous quotes in UKI cmdline addones (Vitaly Kuznetsov) - fedora: arm: updates for 6.12 (Peter Robinson) - redhat/configs: add bootconfig to kernel-tools package (Brian Masney) - Enable CONFIG_SECURITY_LANDLOCK for RHEL (Zbigniew Jędrzejewski-Szmek) [RHEL-8810] - redhat: configs: Drop CONFIG_MEMSTICK_REALTEK_PCI config option (Desnes Nunes) - Update the RHEL_DIFFERENCES help string (Don Zickus) - Put build framework for RT kernel in place for Fedora (Clark Williams) - generic: enable RPMB for all configs that enable MMC (Peter Robinson) - fedora: riscv: Don't override MMC platform defaults (Peter Robinson) - common: only enable on MMC_DW_BLUEFIELD (Peter Robinson) - fedora: aarch64: Stop overriding CONFIG_MMC defaults (Peter Robinson) - commong: The KS7010 driver has been removed (Peter Robinson) - Trim Changelog for 6.12 (Justin M. Forbes) - Enable CONFIG_SECURITY_IPE for Fedora (Zbigniew Jędrzejewski-Szmek) - redhat: allow to override VERSION_ON_UPSTREAM from command line (Jan Stancek) - redhat: configs: Enable CONFIG_SECURITY_TOMOYO in Fedora kernels (Tetsuo Handa) - Revert "Merge branch 'enablement/gpio-expander' into 'os-build'" (Justin M. Forbes) - redhat: configs: decrease CONFIG_PCP_BATCH_SCALE_MAX (Rafael Aquini) - redhat/configs: Enable CONFIG_RCU_TRACE in Fedora/REHL kernels (Waiman Long) - fedora: distable RTL8192E wifi driver (Peter Robinson) - common: arm64: Fixup and cleanup some SCMI options (Peter Robinson) - common: Cleanup ARM_SCMI_TRANSPORT options (Peter Robinson) - configs: fedora/x86: Set CONFIG_CRYPTO_DEV_CCP_DD=y (Hans de Goede) - Turn on ZRAM_WRITEBACK for Fedora (Justin M. Forbes) - configs: rhel: Fix designware I2C controllers related config settings (Hans de Goede) - Enable CONFIG_DMA_NUMA_CMA for x86_64 and aarch64 (Chris von Recklinghausen) - new config in drivers/phy (Izabela Bakollari) - configs: fedora: Unset CONFIG_I2C_DESIGNWARE_CORE on s390x (Hans de Goede) - configs: fedora: Drop duplicate CONFIG_I2C_DESIGNWARE_CORE for x86_64 and aarch64 (Hans de Goede) - Enable DESIGNWARE_CORE for ppc as well (Justin M. Forbes) - Fix up I2C_DESIGNWARE_CORE config for Fedora (Justin M. Forbes) - configs for RT deps (Clark Williams) - CONFIG_OF_OVERLAY: enable for aarch64 and powerpc (Scott Weaver) - redhat: enable changes to build rt variants (Clark Williams) - redhat: clean up pending-rhel (Patrick Talbert) - Enable CONFIG_SCHED_CLASS_EXT for Fedora (Jose Fernandez) - redhat/configs: new config in arch/s390 (Izabela Bakollari) - redhat: ignore rpminspect runpath report on selftests/bpf/cpuv4/urandom_read (Viktor Malik) - [fedora] configs: add end of file newline to CONFIG_DMADEVICES_VDEBUG (Patrick Talbert) - unset CONFIG_DMADEVICES_VDEBUG (cmurf) - stop installing tools/build/Build, gone with ea974028a049f (Thorsten Leemhuis) - redhat/configs: Update LOCKDEP configs (Waiman Long) - uki-virt: Add i18n module (Vitaly Kuznetsov) - uki-virt: Drop DBUS support from initramfs (Vitaly Kuznetsov) - uki-virt: Drop redundant modules from dracut-virt.conf (Vitaly Kuznetsov) - uki-virt: Drop usrmount dracut module (Vitaly Kuznetsov) - redhat: new AMCC_QT2025_PHY config in drivers/net/phy (Patrick Talbert) - redhat: change schedule jobs image from cki-tools to builder-rawhide (Patrick Talbert) - Add CONFIG_SND_SOC_RT1320_SDW to pending-rhel for mismatch (Justin M. Forbes) - Turn on CONFIG_SND_SOC_RT1320_SDW in pending rhel (Justin M. Forbes) - configs: disable CONFIG_AMCC_QT2025_PHY in pending (Patrick Talbert) - fedora: turn on CONFIG_FDMA for powerpc (Patrick Talbert) - Turn on CONFIG_FDMA in pending for Fedora arm and riscv to avoid a mismatch (Justin M. Forbes) - Reset RHEL_RELEASE for 6.12 (Justin M. Forbes) - Consolidate configs into common for 6.11 kernels (Justin M. Forbes) - uki-virt: add systemd-cryptsetup module (Vitaly Kuznetsov) - redhat/docs: fix command to install missing build dependencies (Davide Cavalca) - spec: Respect rpmbuild --without debuginfo (Orgad Shaneh) - fedora/configs: enable GPIO expander drivers (Rupinderjit Singh) - redhat/configs: Switch to the Rust implementation of AX88796B_PHY driver for Fedora (Neal Gompa) - redhat: Turn on support for Rust code in Fedora (Neal Gompa) - Turn off RUST for risc-v (Justin M. Forbes) - gitlab-ci: allow failure of clang LTO pipelines (Michael Hofmann) - redhat/configs: Consolidate the CONFIG_KVM_BOOK3S_HV_P*_TIMING switches (Thomas Huth) - redhat/configs: Consolidate the CONFIG_KVM_SW_PROTECTED_VM switch (Thomas Huth) - redhat/configs: Consolidate the CONFIG_KVM_HYPERV switch (Thomas Huth) - redhat/configs: Consolidate the CONFIG_KVM_AMD_SEV switch (Thomas Huth) - Cleanup some riscv CONFIG locations (Justin M. Forbes) - Fix up pending riscv Fedora configs post merge (Justin M. Forbes) - fedora/configs: Enable SCMI configuration (Rupinderjit Singh) - Remove S390 special config for PHYLIB (Justin M. Forbes) - Disable ELN for riscv64 (Isaiah Stapleton) - redhat: add checks to ensure only building riscv64 on fedora (Isaiah Stapleton) - redhat: Add missing riscv fedora configs (Isaiah Stapleton) - Add riscv64 to the CI pipelines (Isaiah Stapleton) - redhat: Regenerate dist-self-test-data for riscv64 (Isaiah Stapleton) - redhat: Add riscv config changes for fedora (David Abdurachmanov) - redhat: Add support for riscv (David Abdurachmanov) - redhat: Do not include UKI addons twice (Vitaly Kuznetsov) - redhat: update gating.yml (Michael Hofmann) - Remove CONFIG_FSCACHE_DEBUG as it has been renamed (Justin M. Forbes) - Set Fedora configs for 6.11 (Justin M. Forbes) - redhat/configs: Microchip lan743x driver (Izabela Bakollari) - redhat: include resolve_btfids in kernel-devel (Jan Stancek) - redhat: workaround CKI cross compilation for scripts (Jan Stancek) - spec: fix "unexpected argument to non-parametric macro" warnings (Jan Stancek) - Add weakdep support to the kernel spec (Justin M. Forbes) - redhat: configs: disable PF_KEY in RHEL (Sabrina Dubroca) - crypto: akcipher - Disable signing and decryption (Vladis Dronov) [RHEL-54183] {CVE-2023-6240} - crypto: dh - implement FIPS PCT (Vladis Dronov) [RHEL-54183] - crypto: ecdh - disallow plain "ecdh" usage in FIPS mode (Vladis Dronov) [RHEL-54183] - crypto: seqiv - flag instantiations as FIPS compliant (Vladis Dronov) [RHEL-54183] - [kernel] bpf: set default value for bpf_jit_harden (Artem Savkov) [RHEL-51896] - fedora: disable CONFIG_DRM_WERROR (Patrick Talbert) - redhat/configs: Disable dlm in rhel configs (Andrew Price) - rhel: aarch64: enable required PSCI configs (Peter Robinson) - fedora: Enable AF8133J Magnetometer driver (Peter Robinson) - redhat: spec: add cachestat kselftest (Eric Chanudet) - redhat: hmac sign the UKI for FIPS (Vitaly Kuznetsov) - not upstream: Disable vdso getrandom when FIPS is enabled (Herbert Xu) - kernel: config: enable erofs lzma compression (Ian Kent) - fedora: disable RTL8192CU in Fedora (Peter Robinson) - redhat: Fix the ownership of /lib/modules/ directory (Vitaly Kuznetsov) - new configs in drivers/phy (Izabela Bakollari) - Add support to rh_waived cmdline boot parameter (Ricardo Robaina) [RHEL-26170] - redhat/configs: Disable gfs2 in rhel configs (Andrew Price) - redhat/uki_addons/virt: add common FIPS addon (Emanuele Giuseppe Esposito) - redhat/kernel.spec: add uki_addons to create UKI kernel cmdline addons (Emanuele Giuseppe Esposito) - rh_flags: fix failed when register_sysctl_sz rh_flags_table to kernel (Ricardo Robaina) [RHEL-52629] - redhat/dracut-virt.conf: add systemd-veritysetup module (Emanuele Giuseppe Esposito) - redhat/configs: enable CONFIG_LOCK_STAT on the debug kernels for aarch64 (Brian Masney) - redhat/configs: enable CONFIG_KEYBOARD_GPIO_POLLED for RHEL on aarch64 (Luiz Capitulino) - redhat/configs: fedora: Enable new Qualcomm configs (Andrew Halaney) - redhat/configs/fedora: set CONFIG_CRYPTO_CURVE25519_PPC64 (Dan Horák) - fedora: Updates for 6.11 merge (Peter Robinson) - fedora: enable new mipi sensors and devices (Peter Robinson) - arm64: enable CRYPTO_DEV_TEGRA on RHEL (Peter Robinson) - redhat/kernel.spec: fix file listed twice warning for "kernel" subdir (Jan Stancek) - redhat/configs: Double MAX_LOCKDEP_ENTRIES for RT debug kernels (Waiman Long) [RHEL-43425] - Support the first day after a rebase (Don Zickus) - Support 2 digit versions properly (Don Zickus) - Automation cleanups for rebasing rt-devel and automotive-devel (Don Zickus) - fedora: set CONFIG_REGULATOR_RZG2L_VBCTRL as a module for arm64 (Patrick Talbert) - gitlab-ci: restore bot pipeline behavior (Michael Hofmann) - redhat/kernel.spec: drop extra right curly bracket in kernel_kvm_package (Jan Stancek) - redhat/configs: enable gpio_keys driver for RHEL on aarch64 (Luiz Capitulino) - Move NET_VENDOR_MICROCHIP from common to rhel (Justin M. Forbes) - redhat/configs: enable some RTCs for RHEL on aarch64 (Luiz Capitulino) - redhat/configs: enable some regulators for RHEL (Luiz Capitulino) - redhat/config: disable CXL and CXLFLASH drivers (Dan Horák) - Fix up config mismatches in pending (Justin M. Forbes) - redhat/configs: Enable watchdog devices modelled by qemu (Richard W.M. Jones) [RHEL-40937] - rhel: cleanup unused media tuner configs (Peter Robinson) - all: cleanup MEDIA_CONTROLLER options (Peter Robinson) - redhat: kernel.spec: add s390x to livepatching kselftest builds (Joe Lawrence) - Flip CONFIG_DIMLIB back to inline (Justin M. Forbes) - Add vfio/nvgrace-gpu driver CONFIG to RHEL-9.5 ARM64 (Donald Dutile) - Enable CONFIG_RTC_DRV_TEGRA for RHEL (Luiz Capitulino) - redhat: rh_flags: declare proper static methods when !CONFIG_RHEL_DIFFERENCES (Rafael Aquini) - redhat: configs: enable CONFIG_TMPFS_QUOTA for both Fedora and RHEL (Rafael Aquini) - Fix up mismatches in the 6.11 merge window. (Justin M. Forbes) - Reset Changelog after rebase (Justin M. Forbes) - Reset RHEL_RELEASE for the 6.11 cycle (Justin M. Forbes) - redhat/configs: Enable CONFIG_VMWARE_VMCI/CONFIG_VMWARE_VMCI_VSOCKETS for RHEL (Vitaly Kuznetsov) - Consolidate configs to common for 6.10 (Justin M. Forbes) - redhat/configs: Enable CONFIG_PTP_1588_CLOCK_MOCK in kernel-modules-internal (Davide Caratti) - fedora: enabled XE GPU drivers on all arches (Peter Robinson) - Flip SND_SOC_CS35L56_SPI from off to module for RHEL (Justin M. Forbes) - Flip DIMLIB from built-in to module for RHEL (Justin M. Forbes) - Also remove the zfcpdump BASE_SMALL config (Justin M. Forbes) - redhat: Add cgroup kselftests to kernel-selftests-internal (Waiman Long) [RHEL-43556] - Revert "redhat/configs: Disable CONFIG_INFINIBAND_HFI1 and CONFIG_INFINIBAND_RDMAVT" (Kamal Heib) - Remove new for GITLAB_TOKEN (Don Zickus) - Set Fedora configs for 6.10 (Justin M. Forbes) - Fedora: minor driver updates (Peter Robinson) - redhat/configs: Remove obsolete x86 CPU mitigations config files (Waiman Long) - redhat/configs: increase CONFIG_DEFAULT_MMAP_MIN_ADDR from 32K to 64K for aarch64 (Brian Masney) - redhat/configs: Re-enable CONFIG_KEXEC for Fedora (Philipp Rudo) - disable LR_WPAN for RHEL10 (Chris von Recklinghausen) [RHEL-40251] - Turn on USB_SERIAL_F81232 for Fedora (Justin M. Forbes) - redhat/scripts/filtermods.py: show all parent/child kmods in report (Jan Stancek) - redhat/kernel.spec: capture filtermods.py return code (Jan Stancek) - redhat/kernel.spec: fix run of mod-denylist (Jan Stancek) - gitlab-ci: remove unused RHMAINTAINERS variable (Michael Hofmann) - gitlab-ci: use environments for jobs that need access to push/gitlab secrets (Michael Hofmann) - gitlab-ci: default to os-build for all maintenance jobs (Michael Hofmann) - gitlab-ci: use the common git repo setup cki-gating as well (Michael Hofmann) - gitlab-ci: help maintenance jobs to cope with missing private key (Michael Hofmann) - gitlab-ci: use a common git repo setup for all maintenance jobs (Michael Hofmann) - gitlab-ci: move repo setup script into script template holder (Michael Hofmann) - gitlab-ci: move maintenance job DIST variable into common template (Michael Hofmann) - gitlab-ci: move maintenance job rules into common template (Michael Hofmann) - gitlab-ci: move maintenance job retry field into common template (Michael Hofmann) - gitlab-ci: provide common non-secret schedule trigger variables (Michael Hofmann) - gitlab-ci: rename .scheduled_setup to .git_setup (Michael Hofmann) - gitlab-ci: move script snippets into separate template (Michael Hofmann) - gitlab-ci: rename maintenance jobs (Michael Hofmann) - gitlab-ci: introduce job template for maintenance jobs (Michael Hofmann) - Turn on KASAN_HW_TAGS for Fedora aarch64 debug kernels (Justin M. Forbes) - redhat: kernel.spec: add missing sound/soc/sof/sof-audio.h to kernel-devel package (Jaroslav Kysela) - redhat/kernel.spec: fix attributes of symvers file (Jan Stancek) - redhat: add filtermods rule for iommu tests (Jan Stancek) - fedora: arm: Enable basic support for S32G-VNP-RDB3 board (Enric Balletbo i Serra) - redhat: make bnx2xx drivers unmaintained in rhel-10 (John Meneghini) [RHEL-36646 RHEL-41231] - redhat/configs: Disable CONFIG_NFP (Kamal Heib) [RHEL-36647] - Enable CONFIG_PWRSEQ_{SIMPLIE,EMMC} on aarch64 (Charles Mirabile) - Fix SERIAL_SC16IS7XX configs for Fedora (Justin M. Forbes) - Enable ALSA (CONFIG_SND) on aarch64 (Charles Mirabile) [RHEL-40411] - redhat: Remove DIST_BRANCH variable (Eder Zulian) - gitlab-ci: merge ark-latest before tagging cki-gating (Michael Hofmann) - gitlab-ci: do not merge ark-latest for gating pipelines for Rawhide (Michael Hofmann) - disable CONFIG_KVM_INTEL_PROVE_VE (Paolo Bonzini) - redhat: remove the merge subtrees script (Derek Barbosa) - redhat: rhdocs: delete .get_maintainer.conf (Derek Barbosa) - redhat: rhdocs: Remove the rhdocs directory (Derek Barbosa) - redhat/configs: Disable CONFIG_QLA3XXX (Kamal Heib) [RHEL-36646] - redhat/configs: fedora: Enable some drivers for IPU6 support (Hans de Goede) - redhat: add missing UKI_secureboot_cert hunk (Patrick Talbert) - redhat/kernel.spec: keep extra modules in original directories (Jan Stancek) - redhat/configs: Move CONFIG_BLK_CGROUP_IOCOST=y to common/generic (Waiman Long) - Turn on CONFIG_MFD_QCOM_PM8008 for Fedora aarch64 (Justin M. Forbes) - redhat: Build IMA CA certificate into the Fedora kernel (Coiby Xu) - Move CONFIG_RAS_FMPM to the proper location (Aristeu Rozanski) - redhat/configs: Remove CONFIG_NET_ACT_IPT (Ivan Vecera) - gitlab-ci: add kernel-automotive pipelines (Michael Hofmann) - Enable CEC support for TC358743 (Peter Robinson) - fedora: arm: Enable ARCH_R9A09G057 (Peter Robinson) - fedora: updates for the 6.10 kernel (Peter Robinson) - fedora: arm: Enable the MAX96706 GMSL module (Peter Robinson) - redhat: Switch UKI to using its own SecureBoot cert (from system-sb-certs) (Jan Stancek) - redhat: Add RHEL specifc .sbat section to UKI (Jan Stancek) - kernel.spec: add iommu selftests to kernel-selftests-internal (Eder Zulian) [RHEL-32895] - redhat/configs: fedora: aarch64: Re-enable CUSE (Neal Gompa) - redhat: pass correct RPM_VMLINUX_H to bpftool install (Jan Stancek) - rh_flags: Rename rh_features to rh_flags (Ricardo Robaina) [RHEL-32987] - kernel: rh_features: fix reading empty feature list from /proc (Ricardo Robaina) [RHEL-32987] - rh_features: move rh_features entry to sys/kernel (Ricardo Robaina) [RHEL-32987] - rh_features: convert to atomic allocation (Ricardo Robaina) [RHEL-32987] - add rh_features to /proc (Ricardo Robaina) [RHEL-32987] - add support for rh_features (Ricardo Robaina) [RHEL-32987] - Drop kexec_load syscall support (Baoquan He) - New configs in lib/kunit (Fedora Kernel Team) - Turn off KUNIT_FAULT_TEST as it causes problems for CI (Justin M. Forbes) - Add a config entry in pending for CONFIG_DRM_MSM_VALIDATE_XML (Justin M. Forbes) - Flip CONFIG_SND_SOC_CS35L56_SPI in pending to avoid a mismatch (Justin M. Forbes) - Fix up a mismatch for RHEL (Justin M. Forbes) - Reset changelog after rebase (Justin M. Forbes) - Reset RHEL_RELEASE to 0 for 6.10 (Justin M. Forbes) - configs: move CONFIG_BLK_DEV_UBLK into rhel/configs/generic (Ming Lei) - configs: move CONFIG_BLK_SED_OPAL into redhat/configs/common/generic (Ming Lei) - RHEL-21097: rhel: aarch64 stop blocking a number of HW sensors (Peter Robinson) - redhat/configs: enable RTL8822BU for rhel (Jose Ignacio Tornos Martinez) - redhat/configs: remove CONFIG_DMA_PERNUMA_CMA and switch CONFIG_DMA_NUMA_CMA off (Jerry Snitselaar) - redhat: add IMA certificates (Jan Stancek) - redhat/kernel.spec: fix typo in move_kmod_list() variable (Jan Stancek) - redhat: make filtermods.py less verbose by default (Jan Stancek) - scsi: sd: condition probe_type under RHEL_DIFFERENCES (Eric Chanudet) - scsi: sd: remove unused sd_probe_types (Eric Chanudet) - Turn on INIT_ON_ALLOC_DEFAULT_ON for Fedora (Justin M. Forbes) - Consolidate configs to common for 6.9 (Justin M. Forbes) - redhat/rhel_files: move tipc.ko and tipc_diag.ko to modules-extra (Xin Long) [RHEL-23931] - redhat: move amd-pstate-ut.ko to modules-internal (Jan Stancek) - redhat/configs: enable CONFIG_LEDS_TRIGGER_NETDEV also for RHEL (Michal Schmidt) [RHEL-32110] - redhat/configs: Remove CONFIG_AMD_IOMMU_V2 (Jerry Snitselaar) - Set DEBUG_INFO_BTF_MODULES for Fedora (Justin M. Forbes) - redhat: Use redhatsecureboot701 for ppc64le (Jan Stancek) - redhat: switch the kernel package to use certs from system-sb-certs (Jan Stancek) - redhat: replace redhatsecureboot303 signing key with redhatsecureboot601 (Jan Stancek) - redhat: drop certificates that were deprecated after GRUB's BootHole flaw (Jan Stancek) - redhat: correct file name of redhatsecurebootca1 (Jan Stancek) - redhat: align file names with names of signing keys for ppc and s390 (Jan Stancek) - redhat/configs: Enable CONFIG_DM_VDO in RHEL (Benjamin Marzinski) - redhat/configs: Enable DRM_NOUVEAU_GSP_DEFAULT everywhere (Neal Gompa) - kernel.spec: adjust for livepatching kselftests (Joe Lawrence) - redhat/configs: remove CONFIG_TEST_LIVEPATCH (Joe Lawrence) - Turn on CONFIG_RANDOM_KMALLOC_CACHES for Fedora (Justin M. Forbes) - Set Fedora configs for 6.9 (Justin M. Forbes) - gitlab-ci: enable pipelines with c10s buildroot (Michael Hofmann) - Turn on ISM for Fedora (Justin M. Forbes) - redhat/configs: enable CONFIG_TEST_LOCKUP for non-debug kernels (Čestmír Kalina) - redhat/rhel_files: add test_lockup.ko to modules-extra (Čestmír Kalina) - Turn off some Fedora UBSAN options to avoid false positives (Justin M. Forbes) - fedora: aarch64: Enable a QCom Robotics platforms requirements (Peter Robinson) - fedora: updates for 6.9 merge window (Peter Robinson) - gitlab-ci: rename GitLab jobs ark -> rawhide (Michael Hofmann) - gitlab-ci: harmonize DataWarehouse tree names (Michael Hofmann) - redhat/configs: Enable CONFIG_INTEL_IOMMU_SCALABLE_MODE_DEFAULT_ON for rhel (Jerry Snitselaar) - spec: make sure posttrans script doesn't fail if /boot is non-POSIX (glb) - Turn on UBSAN for Fedora (Justin M. Forbes) - Turn on XEN_BALLOON_MEMORY_HOTPLUG for Fedora (Justin M. Forbes) - docs: point out that python3-pyyaml is now required (Thorsten Leemhuis) - Use LLVM=1 for clang_lto build (Nikita Popov) - redhat: fix def_variants.yaml check (Jan Stancek) - redhat: sanity check yaml files (Jan Stancek) - spec: rework filter-mods and mod-denylist (Jan Stancek) - redhat/configs: remove CONFIG_INTEL_MENLOW as it is obsolete. (David Arcari) - arch/x86: Fix XSAVE check for x86_64-v2 check (Prarit Bhargava) - redhat/Makefile.variables: unquote a variable (Thorsten Leemhuis) - redhat/configs: build in Tegra210 SPI driver (Mark Salter) - redhat/configs: aarch64: Enable ARM_FFA driver (Mark Salter) - Base automotive-devel on rt-devel (Don Zickus) - redhat/configs: Enable CONFIG_AMDTEE for x86 (David Arcari) - redhat/configs: enable CONFIG_TEST_LOCKUP for debug kernel (Čestmír Kalina) - kernel.spec: fix libperf-debuginfo content (Jan Stancek) - Turn on DM_VDO for Fedora (Justin M. Forbes) - redhat: make libperf-devel require libperf %{version}-%{release} (Jan Stancek) - kernel.spec: drop custom mode also for System.map ghost entry (Jan Stancek) - Octopus merges are too conservative, serialize instead (Don Zickus) - Add tracking branches for rt-devel (Don Zickus) - all: clean-up i915 (Peter Robinson) - Turn on CONFIG_READ_ONLY_THP_FOR_FS for Fedora (Justin M. Forbes) - redhat/kernel.spec.template: fix rtonly build (Jan Stancek) - redhat/kernel.spec.template: add extra flags for tools build (Scott Weaver) - Add iio-test-gts to mod-internal.list (Thorsten Leemhuis) - redhat/kernel.spec.template: update license (Scott Weaver) - Fix typo in maintaining.rst file (Augusto Caringi) - Enable DRM_CDNS_DSI_J721E for fedora (Andrew Halaney) - gitlab-ci: do not merge ark-latest for gating pipelines (Michael Hofmann) - fedora: Enable MCP9600 (Peter Robinson) - redhat/configs: Enable & consolidate BF-3 drivers config (Luiz Capitulino) - redhat: Fix RT kernel kvm subpackage requires (Juri Lelli) - Add new of_test module to mod-internal.list (Thorsten Leemhuis) - Add new string kunit modules to mod-internal.list (Thorsten Leemhuis) - redhat/kernel.spec.template: enable cross for base/RT (Peter Robinson) - redhat/kernel.spec.template: Fix cross compiling (Peter Robinson) - arch/x86/kernel/setup.c: fixup rh_check_supported (Scott Weaver) - Enable CONFIG_USB_ONBOARD_HUB for RHEL (Charles Mirabile) - redhat/Makefile.cross: Add CROSS_BASEONLY (Prarit Bhargava) - gitlab-ci: fix ark-latest merging for parent pipelines running in forks (Michael Hofmann) - lsm: update security_lock_kernel_down (Scott Weaver) - Fix changelog after rebase (Augusto Caringi) - redhat: remove "END OF CHANGELOG" marker from kernel.changelog (Herton R. Krzesinski) - gitlab-ci: enable all variants for rawhide/eln builder image gating (Michael Hofmann) - Fedora: enable Microchip and their useful drivers (Peter Robinson) - spec: suppress "set +x" output (Jan Stancek) - redhat/configs: Disable CONFIG_RDMA_SIW (Kamal Heib) - redhat/configs: Disable CONFIG_RDMA_RXE (Kamal Heib) - redhat/configs: Disable CONFIG_MLX4 (Kamal Heib) - redhat/configs: Disable CONFIG_INFINIBAND_HFI1 and CONFIG_INFINIBAND_RDMAVT (Kamal Heib) - Consolidate 6.8 configs to common (Justin M. Forbes) - Remove rt-automated and master-rt-devel logic (Don Zickus) - Add support for CI octopus merging (Don Zickus) - redhat/configs: Disable CONFIG_INFINIBAND_VMWARE_PVRDMA (Kamal Heib) - gitlab-ci: fix merge tree URL for gating pipelines (Michael Hofmann) - Revert "net: bump CONFIG_MAX_SKB_FRAGS to 45" (Marcelo Ricardo Leitner) - uki: use systemd-pcrphase dracut module (Gerd Hoffmann) - Add libperf-debuginfo subpackage (Justin M. Forbes) - redhat/kernel.spec.template: Add log_msg macro (Prarit Bhargava) - redhat/configs: Disable CONFIG_INFINIBAND_USNIC (Kamal Heib) - Enable CONFIG_BMI323_I2C=m for Fedora x86_64 builds (Hans de Goede) - gitlab-ci: drop test_makefile job (Scott Weaver) - Enable merge-rt pipeline (Don Zickus) - kernel.spec: include the GDB plugin in kernel-debuginfo (Ondrej Mosnacek) - Turn on DRM_NOUVEAU_GSP_DEFAULT for Fedora (Justin M. Forbes) - Set late new config HDC3020 for Fedora (Justin M. Forbes) - redhat/self-test: Update CROSS_DISABLED_PACKAGES (Prarit Bhargava) - redhat: Do not build libperf with cross builds (Prarit Bhargava) - redhat/configs: enable CONFIG_PINCTRL_INTEL_PLATFORM for RHEL (David Arcari) - redhat/configs: enable CONFIG_PINCTRL_METEORPOINT for RHEL (David Arcari) - redhat/configs: intel pinctrl config cleanup (David Arcari) - redhat/configs: For aarch64/RT, default kstack randomization off (Jeremy Linton) - redhat/Makefile: remove an unused target (Ondrej Mosnacek) - redhat/Makefile: fix setup-source and document its caveat (Ondrej Mosnacek) - redhat/Makefile: fix race condition when making the KABI tarball (Ondrej Mosnacek) - redhat/Makefile: refactor KABI tarball creation (Ondrej Mosnacek) - Turn XFS_SUPPORT_V4 back on for Fedora (Justin M. Forbes) - Add xe to drm module filters (Justin M. Forbes) - Turn off the DRM_XE_KUNIT_TEST for Fedora (Justin M. Forbes) - Flip secureboot signature order (Justin M. Forbes) - all: clean up some removed configs (Peter Robinson) - redhat: add nvidia oot signing key (Dave Airlie) - gitlab-ci: support CI for zfcpdump kernel on ELN (Michael Hofmann) - Fedora configs for 6.8 (Justin M. Forbes) - Turn off CONFIG_INTEL_VSC for Fedora (Justin M. Forbes) - redhat/configs: rhel wireless requests (Jose Ignacio Tornos Martinez) - spec: Set EXTRA_CXXFLAGS for perf demangle-cxx.o (Josh Stone) [2233269] - Flip values for FSCACHE and NETFS_SUPPORT to avoid mismatch (Justin M. Forbes) - Turn on SECURITY_DMESG_RESTRICT (Justin M. Forbes) - redhat: forward-port genlog.py updates from c9s (Jan Stancek) - arch/x86: mark x86_64-v1 and x86_64-v2 processors as deprecated (Prarit Bhargava) - fedora: Enable more Renesas RZ platform drivers (Peter Robinson) - fedora: a few aarch64 drivers and cleanups (Peter Robinson) - fedora: cavium nitrox cnn55xx (Peter Robinson) - Fix dist-get-buildreqs breakage around perl(ExtUtils::Embed) (Don Zickus) - gitlab-ci: merge ark-latest fixes when running ELN pipelines (Michael Hofmann) - gitlab-ci: use all arches for container image gating (Michael Hofmann) - Add new os-build targets: rt-devel and automotive-devel (Don Zickus) - Remove defines forcing tools on, they override cmdline (Justin M. Forbes) - Remove separate license tag for libperf (Justin M. Forbes) - Don't use upstream bpftool version for Fedora package (Justin M. Forbes) - Don't ship libperf.a in libperf-devel (Justin M. Forbes) - add libperf packages and enable perf, libperf, tools and bpftool packages (Thorsten Leemhuis) - Add scaffolding to build the kernel-headers package for Fedora (Justin M. Forbes) - redhat/spec: use distro CFLAGS when building bootstrap bpftool (Artem Savkov) - spec: use just-built bpftool for vmlinux.h generation (Yauheni Kaliuta) [2120968] - gitlab-ci: enable native tools for Rawhide CI (Michael Hofmann) - Revert "Merge branch 'fix-kabi-build-race' into 'os-build'" (Justin M. Forbes) - redhat: configs: fedora: Enable sii902x bridge chip driver (Erico Nunes) - Enable CONFIG_TCP_CONG_ILLINOIS for RHEL (Davide Caratti) - redhat/Makefile: fix setup-source and document its caveat (Ondrej Mosnacek) - redhat/Makefile: fix race condition when making the KABI tarball (Ondrej Mosnacek) - redhat/Makefile: refactor KABI tarball creation (Ondrej Mosnacek) - redhat/configs: Remove HOTPLUG_CPU0 configs (Prarit Bhargava) - gitlab-ci: merge ark-latest before building in MR pipelines (Michael Hofmann) - CI: include aarch64 in CKI container image gating (Tales Aparecida) - redhat: spec: Fix update_scripts run for CentOS builds (Neal Gompa) - New configs in drivers/crypto (Fedora Kernel Team) - net: bump CONFIG_MAX_SKB_FRAGS to 45 (Marcelo Ricardo Leitner) - Enable CONFIG_MARVELL_88Q2XXX_PHY (Izabela Bakollari) - Remove CONFIG_NET_EMATCH_STACK file for RHEL (Justin M. Forbes) - CONFIG_NETFS_SUPPORT should be m after the merge (Justin M. Forbes) - Turn FSCACHE and NETFS from m to y in pending (Justin M. Forbes) - Turn on CONFIG_TCP_AO for Fedora (Justin M. Forbes) - Turn on IAA_CRYPTO_STATS for Fedora (Justin M. Forbes) - fedora: new drivers and cleanups (Peter Robinson) - Turn on Renesas RZ for Fedora IOT rhbz2257913 (Justin M. Forbes) - redhat: filter-modules.sh.rhel: add dell-smm-hwmon (Scott Weaver) - Add CONFIG_INTEL_MEI_GSC_PROXY=m for DRM 9.4 stable backport (Mika Penttilä) - Set configs for ZRAM_TRACK_ENTRY_ACTIME (Justin M. Forbes) - Add python3-pyyaml to buildreqs for kernel-docs (Justin M. Forbes) - Add nb7vpq904m to singlemods for ppc64le (Thorsten Leemhuis) - include drm bridge helpers in kernel-core package (Thorsten Leemhuis) - Add dell-smm-hwmon to singlemods (Thorsten Leemhuis) - Add drm_gem_shmem_test to mod-internal.list (Thorsten Leemhuis) - redhat: kABI: add missing RH_KABI_SIZE_ALIGN_CHECKS Kconfig option (Sabrina Dubroca) - redhat: rh_kabi: introduce RH_KABI_EXCLUDE_WITH_SIZE (Sabrina Dubroca) - redhat: rh_kabi: move semicolon inside __RH_KABI_CHECK_SIZE (Sabrina Dubroca) - Fix up ZRAM_TRACK_ENTRY_ACTIME in pending (Justin M. Forbes) - random: replace import_single_range() with import_ubuf() (Justin M. Forbes) - Flip CONFIG_INTEL_PMC_CORE to m for Fedora (Justin M. Forbes) - Add CONFIG_ZRAM_TRACK_ENTRY_ACTIME=y to avoid a mismatch (Justin M. Forbes) - common: cleanup MX3_IPU (Peter Robinson) - all: The Octeon MDIO driver is aarch64/mips (Peter Robinson) - common: rtc: remove bq4802 config (Peter Robinson) - common: de-dupe MARVELL_GTI_WDT (Peter Robinson) - all: Remove CAN_BXCAN (Peter Robinson) - common: cleanup SND_SOC_ROCKCHIP (Peter Robinson) - common: move RHEL DP83867_PHY to common (Peter Robinson) - common: Make ASYMMETRIC_KEY_TYPE enable explicit (Peter Robinson) - common: Disable aarch64 ARCH_MA35 universally (Peter Robinson) - common: arm64: enable Tegra234 pinctrl driver (Peter Robinson) - rhel: arm64: Enable qoriq thermal driver (Peter Robinson) - common: aarch64: Cleanup some i.MX8 config options (Peter Robinson) - all: EEPROM_LEGACY has been removed (Peter Robinson) - all: rmeove AppleTalk hardware configs (Peter Robinson) - all: cleanup: remove references to SLOB (Peter Robinson) - all: cleanup: Drop unnessary BRCMSTB configs (Peter Robinson) - all: net: remove retired network schedulers (Peter Robinson) - all: cleanup removed CONFIG_IMA_TRUSTED_KEYRING (Peter Robinson) - BuildRequires: lld for build with selftests for x86 (Jan Stancek) - spec: add keyutils to selftest-internal subpackage requirements (Artem Savkov) [2166911] - redhat/spec: exclude liburandom_read.so from requires (Artem Savkov) [2120968] - rtla: sync summary text with upstream and update Requires (Jan Stancek) - uki-virt: add systemd-sysext dracut module (Gerd Hoffmann) - uki-virt: add virtiofs dracut module (Gerd Hoffmann) - common: disable the FB device creation (Peter Robinson) - s390x: There's no FB on Z-series (Peter Robinson) - fedora: aarch64: enable SM_VIDEOCC_8350 (Peter Robinson) - fedora: arm64: enable ethernet on newer TI industrial (Peter Robinson) - fedora: arm64: Disable VIDEO_IMX_MEDIA (Peter Robinson) - fedora: use common config for Siemens Simatic IPC (Peter Robinson) - fedora: arm: enable Rockchip SPI flash (Peter Robinson) - fedora: arm64: enable DRM_TI_SN65DSI83 (Peter Robinson) - kernel.spec: remove kernel-smp reference from scripts (Jan Stancek) - redhat: do not compress the full kernel changelog in the src.rpm (Herton R. Krzesinski) - Auto consolidate configs for the 6.7 cycle (Justin M. Forbes) - Enable sound for a line of Huawei laptops (TomZanna) - fedora: a few cleanups and driver enablements (Peter Robinson) - fedora: arm64: cleanup Allwinner Pinctrl drivers (Peter Robinson) - fedora: aarch64: Enable some DW drivers (Peter Robinson) - redhat: ship all the changelog from source git into kernel-doc (Herton R. Krzesinski) - redhat: create an empty changelog file when changing its name (Herton R. Krzesinski) - redhat/self-test: Remove --all from git query (Prarit Bhargava) - Disable accel drivers for Fedora x86 (Kate Hsuan) - redhat: scripts: An automation script for disabling unused driver for x86 (Kate Hsuan) - Fix up Fedora LJCA configs and filters (Justin M. Forbes) - Fedora configs for 6.7 (Justin M. Forbes) - Some Fedora config updates for MLX5 (Justin M. Forbes) - Turn on DRM_ACCEL drivers for Fedora (Justin M. Forbes) - redhat: enable the kfence test (Nico Pache) - redhat/configs: Enable UCLAMP_TASK for PipeWire and WirePlumber (Neal Gompa) - Turn on CONFIG_SECURITY_DMESG_RESTRICT for Fedora (Justin M. Forbes) - Turn off shellcheck for the fedora-stable-release script (Justin M. Forbes) - Add some initial Fedora stable branch script to redhat/scripts/fedora/ (Justin M. Forbes) - redhat: disable iptables-legacy compatibility layer (Florian Westphal) - redhat: disable dccp conntrack support (Florian Westphal) - configs: enable netfilter_netlink_hook in fedora too (Florian Westphal) - ext4: Mark mounting fs-verity filesystems as tech-preview (Alexander Larsson) - erofs: Add tech preview markers at mount (Alexander Larsson) - Enable fs-verity (Alexander Larsson) - Enable erofs (Alexander Larsson) - aarch64: enable uki (Gerd Hoffmann) - redhat: enable CONFIG_SND_SOC_INTEL_SOF_DA7219_MACH as a module for x86 (Patrick Talbert) - Turn CONFIG_MFD_CS42L43_SDW on for RHEL (Justin M. Forbes) - Enable cryptographic acceleration config flags for PowerPC (Mamatha Inamdar) - Also make vmlinuz-virt.efi world readable (Zbigniew Jędrzejewski-Szmek) - Drop custom mode for System.map file (Zbigniew Jędrzejewski-Szmek) - Add drm_exec_test to mod-internal.list for depmod to succeed (Mika Penttilä) - RHEL 9.4 DRM backport (upto v6.6 kernel), sync Kconfigs (Mika Penttilä) - Turn on USB_DWC3 for Fedora (rhbz 2250955) (Justin M. Forbes) - redhat/configs: Move IOMMUFD to common (Alex Williamson) - redhat: Really remove cpupower files (Prarit Bhargava) - redhat: remove update_scripts.sh (Prarit Bhargava) - Fix s390 zfcpfdump bpf build failures for cgroups (Don Zickus) - Flip CONFIG_NVME_AUTH to m in pending (Justin M. Forbes) - Turn CONFIG_SND_SOC_INTEL_AVS_MACH_RT5514 on for Fedora x86 (Jason Montleon) - kernel/rh_messages.c: Mark functions as possibly unused (Prarit Bhargava) - Add snd-hda-cirrus-scodec-test to mod-internal.list (Scott Weaver) - Turn off BPF_SYSCALL in pending for zfcpdump (Justin M. Forbes) - Add mean_and_variance_test to mod-internal.list (Justin M. Forbes) - Add cfg80211-tests and mac80211-tests to mod-internal.list (Justin M. Forbes) - Turn on CONFIG_MFD_CS42L43_SDW for RHEL in pending (Justin M. Forbes) - Turn on bcachefs for Fedora (Justin M. Forbes) - redhat: configs: fedora: Enable QSEECOM and friends (Andrew Halaney) - Add clk-fractional-divider_test to mod-internal.list (Thorsten Leemhuis) - Add gso_test to mod-internal.list (Thorsten Leemhuis) - Add property-entry-test to mod-internal.list (Thorsten Leemhuis) - Fedora 6.7 configs part 1 (Justin M. Forbes) - [Scheduled job] Catch config mismatches early during upstream merge (Don Zickus) - redhat/self-test: Update data for KABI xz change (Prarit Bhargava) - redhat/scripts: Switch KABI tarballs to xz (Prarit Bhargava) - redhat/kernel.spec.template: Switch KABI compression to xz (Prarit Bhargava) - redhat: self-test: Use a more complete SRPM file suffix (Andrew Halaney) - redhat: makefile: remove stray rpmbuild --without (Eric Chanudet) - Consolidate configs into common for 6.6 (Justin M. Forbes) - Updated Fedora configs (Justin M. Forbes) - Turn on UFSHCD for Fedora x86 (Justin M. Forbes) - redhat: configs: generic: x86: Disable CONFIG_VIDEO_OV01A10 for x86 platform (Hans de Goede) - redhat: remove pending-rhel CONFIG_XFS_ASSERT_FATAL file (Patrick Talbert) - New configs in fs/xfs (Fedora Kernel Team) - crypto: rng - Override drivers/char/random in FIPS mode (Herbert Xu) - random: Add hook to override device reads and getrandom(2) (Herbert Xu) - redhat/configs: share CONFIG_ARM64_ERRATUM_2966298 between rhel and fedora (Mark Salter) - configs: Remove S390 IOMMU config options that no longer exist (Jerry Snitselaar) - redhat: docs: clarify where bugs and issues are created (Scott Weaver) - redhat/scripts/rh-dist-git.sh does not take any arguments: fix error message (Denys Vlasenko) - Add target_branch for gen_config_patches.sh (Don Zickus) - redhat: disable kunit by default (Nico Pache) - redhat/configs: enable the AMD_PMF driver for RHEL (David Arcari) - Make CONFIG_ADDRESS_MASKING consistent between fedora and rhel (Chris von Recklinghausen) - CI: add ark-latest baseline job to tag cki-gating for successful pipelines (Michael Hofmann) - CI: provide child pipelines for CKI container image gating (Michael Hofmann) - CI: allow to run as child pipeline (Michael Hofmann) - CI: provide descriptive pipeline name for scheduled pipelines (Michael Hofmann) - CI: use job templates for variant variables (Michael Hofmann) - redhat/kernel.spec.template: simplify __modsign_install_post (Jan Stancek) - Fedora filter updates after configs (Justin M. Forbes) - Fedora configs for 6.6 (Justin M. Forbes) - redhat/configs: Freescale Layerscape SoC family (Steve Best) - Add clang MR/baseline pipelines (Michael Hofmann) - CI: Remove unused kpet_tree_family (Nikolai Kondrashov) - Add clang config framework (Don Zickus) - Apply partial snippet configs to all configs (Don Zickus) - Remove unpackaged kgcov config files (Don Zickus) - redhat/configs: enable missing Kconfig options for Qualcomm RideSX4 (Brian Masney) - enable CONFIG_ADDRESS_MASKING for x86_64 (Chris von Recklinghausen) - common: aarch64: enable NXP Flex SPI (Peter Robinson) - fedora: Switch TI_SCI_CLK and TI_SCI_PM_DOMAINS symbols to built-in (Javier Martinez Canillas) - kernel.spec: adjust build option comment (Michael Hofmann) - kernel.spec: allow to enable arm64_16k variant (Michael Hofmann) - gitlab-ci: enable build-only pipelines for Rawhide/16k/aarch64 (Michael Hofmann) - kernel.spec.template: Fix --without bpftool (Prarit Bhargava) - redhat/configs: NXP BBNSM Power Key Driver (Steve Best) - redhat/self-test: Update data for cross compile fields (Prarit Bhargava) - redhat/Makefile.cross: Add message for disabled subpackages (Prarit Bhargava) - redhat/Makefile.cross: Update cross targets with disabled subpackages (Prarit Bhargava) - Remove XFS_ASSERT_FATAL from pending-fedora (Justin M. Forbes) - Change default pending for XFS_ONLINE_SCRUB_STATSas it now selects XFS_DEBUG (Justin M. Forbes) - gitlab-ci: use --with debug/base to select kernel variants (Michael Hofmann) - kernel.spec: add rpmbuild --without base option (Michael Hofmann) - redhat: spec: Fix typo for kernel_variant_preun for 16k-debug flavor (Neal Gompa) - Turn off appletalk for fedora (Justin M. Forbes) - New configs in drivers/media (Fedora Kernel Team) - redhat/docs: Add a mention of bugzilla for bugs (Prarit Bhargava) - Fix the fixup of Fedora release (Don Zickus) - Fix Fedora release scheduled job (Don Zickus) - Move squashfs to kernel-modules-core (Justin M. Forbes) - redhat: Explicitly disable CONFIG_COPS (Vitaly Kuznetsov) - redhat: Add dist-check-licenses target (Vitaly Kuznetsov) - redhat: Introduce "Verify SPDX-License-Identifier tags" selftest (Vitaly Kuznetsov) - redhat: Use kspdx-tool output for the License: field (Vitaly Kuznetsov) - Rename pipeline repo branch and DW tree names (Michael Hofmann) - Adjust comments that refer to ARK in a Rawhide context (Michael Hofmann) - Rename variable names starting with ark- to rawhide- (Michael Hofmann) - Rename trigger-ark to trigger-rawhide (Michael Hofmann) - Fix up config mismatches for Fedora (Justin M. Forbes) - redhat/configs: Texas Instruments Inc. K3 multicore SoC architecture (Steve Best) - Flip CONFIG_VIDEO_V4L2_SUBDEV_API in pending RHEL due to mismatch (Justin M. Forbes) - CONFIG_HW_RANDOM_HISI: move to common and set to m (Scott Weaver) - Turn off CONFIG_MEMORY_HOTPLUG_DEFAULT_ONLINE for Fedora s390x (Justin M. Forbes) - Disable tests for ELN realtime pipelines (Michael Hofmann) - New configs in mm/Kconfig (Fedora Kernel Team) - Flip CONFIG_SND_SOC_CS35L56_SDW to m and clean up (Justin M. Forbes) - Add drm_exec_test to mod-internal.list (Thorsten Leemhuis) - Add new pending entry for CONFIG_SND_SOC_CS35L56_SDW to fix mismatch (Justin M. Forbes) - Fix tarball creation logic (Don Zickus) - redhat: bump libcpupower soname to match upstream (Patrick Talbert) - Turn on MEMFD_CREATE in pending as it is selected by CONFIG_TMPFS (Justin M. Forbes) - redhat: drop unneeded build-time dependency gcc-plugin-devel (Coiby Xu) - all: x86: move wayward x86 specific config home (Peter Robinson) - all: de-dupe non standard config options (Peter Robinson) - all: x86: clean up microcode loading options (Peter Robinson) - common: remove unnessary CONFIG_SND_MESON_AXG* (Peter Robinson) - redhat: Fix UKI install with systemd >= 254 (Vitaly Kuznetsov) - redhat: Use named parameters for kernel_variant_posttrans()/kernel_variant_preun() (Vitaly Kuznetsov) - redhat/kernel.spec.template: update compression variables to support zstd (Brian Masney) - Consolidate configs to common for 6.5 (Justin M. Forbes) - Remove unused config entry for Fedora (Justin M. Forbes) - redhat/self-test: Remove rpmlint test (Prarit Bhargava) - Remove the armv7 config directory from Fedora again (Justin M. Forbes) - Enable CONFIG_EXPERT for both RHEL and Fedora (Justin M. Forbes) - redhat/configs: Enable CONFIG_DEVICE_PRIVATE on aarch64 (David Hildenbrand) [2231407] - redhat/configs: disable CONFIG_ROCKCHIP_ERRATUM_3588001 for RHEL (Mark Salter) - redhat: shellcheck fixes (Prarit Bhargava) - redhat/configs: enable tegra114 SPI (Mark Salter) - all: properly cleanup firewire once and for all (Peter Robinson) - Fix up filters for Fedora (Justin M. Forbes) - New configs in arch/x86 (Fedora Kernel Team) - Add an armv7 directory back for the Fedora configs (Justin M. Forbes) - Fedora 6.5 config updates (Justin M. Forbes) - Turn off DMABUF_SYSFS_STATS (Justin M. Forbes) - CI: rawhide_release: switch to using script to push (Don Zickus) - redhat/self-test: Update self-test data (Prarit Bhargava) - redhat/scripts/cross-compile: Update download_cross.sh (Prarit Bhargava) - redhat/Makefile.cross: Remove ARCH selection code (Prarit Bhargava) - redhat/Makefile.cross: Update script (Prarit Bhargava) - Fix interruptible non MR jobs (Michael Hofmann) - all: run evaluate_configs to de-dupe merged aarch64 (Peter Robinson) - all: arm: merge the arm and arm/aarch64 (Peter Robinson) - fedora: remove ARMv7 AKA armhfp configurations (Peter Robinson) - fedora: remove ARMv7 AKA armhfp support (Peter Robinson) - redhat/configs: enable CONFIG_VIRTIO_MEM on aarch64 (David Hildenbrand) [2044155] - redhat/configs: enable CONFIG_MEMORY_HOTREMOVE aarch64 (David Hildenbrand) [2062054] - redhat: Add arm64-16k kernel flavor scaffold for 16K page-size'd AArch64 (Neal Gompa) - fedora: enable i3c on aarch64 (Peter Robinson) - redhat/configs: Remove `CONFIG_HZ_1000 is not set` for aarch64 (Enric Balletbo i Serra) - redhat/configs: turn on the framework for SPI NOR for ARM (Steve Best) - configs: add new ChromeOS UART driver (Mark Langsdorf) - configs: add new ChromeOS Human Presence Sensor (Mark Langsdorf) - redhat/configs: Enable CONFIG_NVIDIA_WMI_EC_BACKLIGHT for both Fedora and RHEL (Kate Hsuan) - redhat/configs: Texas Instruments INA3221 driver (Steve Best) - arm: i.MX: Some minor NXP i.MX cleanups (Peter Robinson) - Description: Set config for Tegra234 pinctrl driver (Joel Slebodnick) - Update RPM Scriptlet for kernel-install Changes (Jonathan Steffan) - [CI] add exit 0 to the end of CI scripts (Don Zickus) - redhat: configs: Disable CONFIG_CRYPTO_STATS since performance issue for storage (Kate Hsuan) [2227793] - Remove obsolete variable from gitlab-ci.yml (Ondrej Kinst) - redhat/configs: Move GVT-g to Fedora only (Alex Williamson) - [CI] Make sure we are on correct branch before running script (Don Zickus) - CI: ark-update-configs: sync push command and output (Don Zickus) - CI: ark-update-configs: misc changes (Don Zickus) - CI: sync ark-create-release push commands with output (Don Zickus) - CI: ark-create-release: Add a robust check if nothing changed (Don Zickus) - CI: Remove legacy tag check cruft (Don Zickus) - CI: Introduce simple environment script (Don Zickus) - redhat/configs: Disable FIREWIRE for RHEL (Prarit Bhargava) - redhat/scripts/rh-dist-git.sh: print list of uploaded files (Denys Vlasenko) - redhat/scripts/expand_srpm.sh: add missing function, robustify (Denys Vlasenko) - redhat: Enable HSR and PRP (Felix Maurer) - redhat/scripts/rh-dist-git.sh: fix outdated message and comment (Denys Vlasenko) - redhat/configs: Disable CONFIG_I8K (Prarit Bhargava) - Make sure posttrans script doesn't fail if restorecon is not installed (Daan De Meyer) - Update filters for new config items (Justin M. Forbes) - More Fedora 6.5 configs (Justin M. Forbes) - redhat/configs: disable pre-UVC cameras for RHEL on aarch64 (Dean Nelson) - redhat/configs: enable CONFIG_MEDIA_SUPPORT for RHEL on aarch64 (Dean Nelson) - move ownership of /lib/modules// to kernel-core (Thorsten Leemhuis) - Let kernel-modules-core own the files depmod generates. (Thorsten Leemhuis) - redhat: configs: Enable CONFIG_TYPEC_STUSB160X for rhel on aarch64 (Desnes Nunes) - Add filters for ptp_dfl_tod on Fedora (Justin M. Forbes) - Fedora 6.5 configs part 1 (Justin M. Forbes) - fedora: enable CONFIG_ZYNQMP_IPI_MBOX as a builtin in pending-fedora (Patrick Talbert) - fedora: arm: some minor updates (Peter Robinson) - fedora: bluetooth: enable AOSP extensions (Peter Robinson) - fedora: wifi: tweak ZYDAS WiFI config options (Peter Robinson) - scsi: sd: Add "probe_type" module parameter to allow synchronous probing (Ewan D. Milne) [2140017] - redhat/configs: allow IMA to use MOK keys (Coiby Xu) - Simplify documentation jobs (Michael Hofmann) - Auto-cancel pipelines only on MRs (Michael Hofmann) - CI: Call script directly (Don Zickus) - CI: Remove stale TAG and Makefile cruft (Don Zickus) - CI: Move os-build tracking to common area (Don Zickus) - redhat: use the eln builder for daily jobs (Patrick Talbert) - redhat: set CONFIG_XILINX_WINDOW_WATCHDOG as disabled in pending (Patrick Talbert) - Add baseline ARK/ELN pipelines (Michael Hofmann) - Simplify job rules (Michael Hofmann) - Build ELN srpm for bot changes (Michael Hofmann) - Run RH selftests for ELN (Michael Hofmann) - Simplify job templates (Michael Hofmann) - Extract rules to allow orthogonal configuration (Michael Hofmann) - Require ELN pipelines if started automatically (Michael Hofmann) - Add ARK debug pipeline (Michael Hofmann) - Extract common parts of child pipeline job (Michael Hofmann) - Move ARK pipeline variables into job template (Michael Hofmann) - Simplify ARK pipeline rules (Michael Hofmann) - Change pathfix.py to %py3_shebang_fix (Justin M. Forbes) - Turn on NET_VENDOR_QUALCOMM for Fedora to enable rmnet (Justin M. Forbes) - redhat: add intel-m10-bmc-hwmon to filter-modules singlemods list (Patrick Talbert) - fedira: enable pending-fedora CONFIG_CPUFREQ_DT_PLATDEV as a module (Patrick Talbert) - redhat: fix the 'eln BUILD_TARGET' self-test (Patrick Talbert) - redhat: update the self-test-data (Patrick Talbert) - redhat: remove trailing space in dist-dump-variables output (Patrick Talbert) - Allow ELN pipelines failures (Michael Hofmann) - Enable cs-like CI (Michael Hofmann) - Allow to auto-cancel redundant pipelines (Michael Hofmann) - Remove obsolete unused trigger variable (Michael Hofmann) - Fix linter warnings in .gitlab-ci.yml (Michael Hofmann) - config: wifi: debug options for ath11k, brcm80211 and iwlwifi (Íñigo Huguet) - redhat: allow dbgonly cross builds (Jan Stancek) - redhat/configs: Clean up x86-64 call depth tracking configs (Waiman Long) - redhat: move SND configs from pending-rhel to rhel (Patrick Talbert) - Fix up armv7 configs for Fedora (Justin M. Forbes) - redhat: Set pending-rhel x86 values for various SND configs (Patrick Talbert) - redhat: update self-test data (Patrick Talbert) - redhat: ignore SPECBPFTOOLVERSION/bpftoolversion in self-test create-data.sh (Patrick Talbert) - fedora/rhel: Move I2C_DESIGNWARE_PLATFORM, I2C_SLAVE, & GPIOLIB from pending (Patrick Talbert) - redhat/filter-modules.sh.rhel: add needed deps for intel_rapl_tpmi (Jan Stancek) - fedora: Enable CONFIG_SPI_SLAVE (Patrick Talbert) - fedora/rhel: enable I2C_DESIGNWARE_PLATFORM, I2C_SLAVE, and GPIOLIB (Patrick Talbert) - fedora: Enable CONFIG_SPI_SLAVE in fedora-pending (Patrick Talbert) - redhat: remove extra + (plus) from meta package Requires definitions (Patrick Talbert) - Add intel-m10-bmc-hwmon to singlemods (Thorsten Leemhuis) - Add hid-uclogic-test to mod-internal.list (Thorsten Leemhuis) - Add checksum_kunit.ko to mod-internal.list (Thorsten Leemhuis) - Add strcat_kunit to mod-internal.list (Thorsten Leemhuis) - Add input_test to mod-intenal.list (Thorsten Leemhuis) - Revert "Remove EXPERT from ARCH_FORCE_MAX_ORDER for aarch64" (Justin M. Forbes) - Fix up rebase issue with CONFIG_ARCH_FORCE_MAX_ORDER (Justin M. Forbes) - redhat/kernel.spec.template: Disable 'extracting debug info' messages (Prarit Bhargava) - kernel/rh_messages.c: Another gcc12 warning on redundant NULL test (Florian Weimer) [2216678] - redhat: fix signing for realtime and arm64_64k non-debug variants (Jan Stancek) - redhat: treat with_up consistently (Jan Stancek) - redhat: make with_realtime opt-in (Jan Stancek) - redhat/configs: Disable qcom armv7 drippings in the aarch64 tree (Jeremy Linton) - kernel.spec: drop obsolete ldconfig (Jan Stancek) - Consolidate config items to common for 6.4 cycle (Justin M. Forbes) - Turn on CO?NFIg_RMNET for Fedora (Justin M. Forbes) - redhat/configs: enable CONFIG_MANA_INFINIBAND=m for ARK (Vitaly Kuznetsov) - redhat/config: common: Enable CONFIG_GPIO_SIM for software development (Kate Hsuan) - redhat: fix problem with RT kvm modules listed twice in rpm generation (Clark Williams) - redhat: turn off 64k kernel builds with rtonly (Clark Williams) - redhat: turn off zfcpdump for rtonly (Clark Williams) - redhat: don't allow with_rtonly to turn on unsupported arches (Clark Williams) - redhat: update self-test data for addition of RT and 64k-page variants (Clark Williams) - redhat: fix realtime and efiuki build conflict (Jan Stancek) - arm64-64k: Add new kernel variant to RHEL9/CS9 for 64K page-size'd ARM64 (Donald Dutile) [2153073] - redhat: TEMPORARY set configs to deal with PREEMPT_RT not available (Clark Williams) - redhat: TEMPORARY default realtime to off (Clark Williams) - redhat: moved ARM errata configs to arm dir (Clark Williams) - redhat: RT packaging changes (Clark Williams) - redhat: miscellaneous commits needed due to CONFIG_EXPERT (Clark Williams) - redhat: realtime config entries (Clark Williams) - common: remove deleted USB PCCARD drivers (Peter Robinson) - fedora: further cleanup of pccard/cardbus subsystem (Peter Robinson) - common: properly disable PCCARD subsystem (Peter Robinson) - redhat/configs: arm: enable SERIAL_TEGRA UART for RHEL (Mark Salter) - redhat/configs: enable CONFIG_X86_AMD_PSTATE_UT (David Arcari) - redhat/configs: Enable CONFIG_TCG_VTPM_PROXY for RHEL (Štěpán Horáček) - redhat: do not package *.mod.c generated files (Denys Vlasenko) - ALSA configuration changes for ARK/RHEL 9.3 (Jaroslav Kysela) - spec: remove resolve_btfids from kernel-devel (Viktor Malik) - Fix typo in filter-modules (Justin M. Forbes) - redhat/configs: Enable CONFIG_INIT_STACK_ALL_ZERO for RHEL (Josh Poimboeuf) - Remove CONFIG_ARCH_FORCE_MAX_ORDER for aarch64 (Justin M. Forbes) - Fix up config and filter for PTP_DFL_TOD (Justin M. Forbes) - redhat/configs: IMX8ULP pinctrl driver (Steve Best) - redhat/configs: increase CONFIG_FRAME_WARN for Fedora on aarch64 (Brian Masney) - redhat/configs: add two missing Kconfig options for the Thinkpad x13s (Brian Masney) - Fedora configs for 6.4 (Justin M. Forbes) - Change aarch64 CONFIG_ARCH_FORCE_MAX_ORDER to 10 for 4K pages (Justin M. Forbes) - kernel.spec: remove "RPM_VMLINUX_H=$DevelDir/vmlinux.h" code chunk in %install (Denys Vlasenko) - redhat/configs: aarch64: Turn on Display for OnePlus 6 (Eric Curtin) - redhat/configs: NXP i.MX93 pinctrl, clk, analog to digital converters (Steve Best) - redhat/configs: Enable CONFIG_SC_GPUCC_8280XP for fedora (Andrew Halaney) - redhat/configs: Enable CONFIG_QCOM_IPCC for fedora (Andrew Halaney) - Add rv subpackage for kernel-tools (John Kacur) [2188441] - redhat/configs: NXP i.MX9 family (Steve Best) - redhat/genlog.py: add support to list/process zstream Jira tickets (Herton R. Krzesinski) - redhat: fix duplicate jira issues in the resolves line (Herton R. Krzesinski) - redhat: add support for Jira issues in changelog (Herton R. Krzesinski) - redhat/configs: turn on IMX8ULP CCM Clock Driver (Steve Best) - redhat: update filter-modules fsdrvs list to reference smb instead of cifs (Patrick Talbert) - Turn off some debug options found to impact performance (Justin M. Forbes) - wifi: rtw89: enable RTL8852BE card in RHEL (Íñigo Huguet) - redhat/configs: enable TEGRA186_GPC_DMA for RHEL (Mark Salter) - Move imx8m configs from fedora to common (Mark Salter) - redhat/configs: turn on lpuart serial port support Driver (Steve Best) [2208834] - Turn off DEBUG_VM for non debug Fedora kernels (Justin M. Forbes) - Enable CONFIG_BT on aarch64 (Charles Mirabile) - redhat/configs: turn on CONFIG_MARVELL_CN10K_TAD_PMU (Michal Schmidt) [2042240] - redhat/configs: Fix enabling MANA Infiniband (Kamal Heib) - Fix file listing for symvers in uki (Justin M. Forbes) - Fix up some Fedora config items (Justin M. Forbes) - enable efifb for Nvidia (Justin M. Forbes) - kernel.spec: package unstripped test_progs-no_alu32 (Felix Maurer) - Turn on NFT_CONNLIMIT for Fedora (Justin M. Forbes) - Include the information about builtin symbols into kernel-uki-virt package too (Vitaly Kuznetsov) - redhat/configs: Fix incorrect configs location and content (Vladis Dronov) - redhat/configs: turn on CONFIG_MARVELL_CN10K_DDR_PMU (Michal Schmidt) [2042241] - redhat: configs: generic: x86: Disable CONFIG_VIDEO_OV2740 for x86 platform (Kate Hsuan) - Enable IO_URING for RHEL (Justin M. Forbes) - Turn on IO_URING for RHEL in pending (Justin M. Forbes) - redhat: Remove editconfig (Prarit Bhargava) - redhat: configs: fix CONFIG_WERROR replace in build_configs (Jan Stancek) - redhat/configs: enable Maxim MAX77620 PMIC for RHEL (Mark Salter) - kernel.spec: skip kernel meta package when building without up (Jan Stancek) - redhat/configs: enable RDMA_RXE for RHEL (Kamal Heib) [2022578] - redhat/configs: update RPCSEC_GSS_KRB5 configs (Scott Mayhew) - redhat/Makefile: Support building linux-next (Thorsten Leemhuis) - redhat/Makefile: support building stable-rc versions (Thorsten Leemhuis) - redhat/Makefile: Add target to print DISTRELEASETAG (Thorsten Leemhuis) - Remove EXPERT from ARCH_FORCE_MAX_ORDER for aarch64 (Justin M. Forbes) - Revert "Merge branch 'unstripped-no_alu32' into 'os-build'" (Patrick Talbert) - configs: Enable CONFIG_PAGE_POOL_STATS for common/generic (Patrick Talbert) - redhat/configs: enable CONFIG_DELL_WMI_PRIVACY for both RHEL and Fedora (David Arcari) - kernel.spec: package unstripped test_progs-no_alu32 (Felix Maurer) - bpf/selftests: fix bpf selftests install (Jerome Marchand) - kernel.spec: add bonding selftest (Hangbin Liu) - Change FORCE_MAX_ORDER for ppc64 to be 8 (Justin M. Forbes) - kernel.spec.template: Add global compression variables (Prarit Bhargava) - kernel.spec.template: Use xz for KABI (Prarit Bhargava) - kernel.spec.template: Remove gzip related aarch64 code (Prarit Bhargava) - Add apple_bl to filter-modules (Justin M. Forbes) - Add handshake-test to mod-intenal.list (Justin M. Forbes) - Add regmap-kunit to mod-internal.list (Justin M. Forbes) - configs: set CONFIG_PAGE_POOL_STATS (Patrick Talbert) - Add apple_bl to fedora module_filter (Justin M. Forbes) - Fix up some config mismatches in new Fedora config items (Justin M. Forbes) - redhat/configs: disable CONFIG_USB_NET_SR9700 for aarch64 (Jose Ignacio Tornos Martinez) - Fix up the RHEL configs for xtables and ipset (Justin M. Forbes) - ark: enable wifi on aarch64 (Íñigo Huguet) - fedora: wifi: hermes: disable 802.11b driver (Peter Robinson) - fedora: wifi: libertas: use the LIBERTAS_THINFIRM driver (Peter Robinson) - fedora: wifi: disable Zydas vendor (Peter Robinson) - redhat: fix python ValueError in error path of merge.py (Clark Williams) - fedora: arm: minor updates (Peter Robinson) - kernel.spec: Fix UKI naming to comply with BLS (Philipp Rudo) - redhat/kernel.spec.template: Suppress 'extracting debug info' noise in build log (Prarit Bhargava) - Fedora 6.3 configs part 2 (Justin M. Forbes) - redhat/configs: Enable CONFIG_X86_KERNEL_IBT for Fedora and ARK (Josh Poimboeuf) - kernel.spec: gcov: make gcov subpackages per variant (Jan Stancek) - kernel.spec: Gemini: add Epoch to perf and rtla subpackages (Jan Stancek) - kernel.spec: Gemini: fix header provides for upgrade path (Jan Stancek) - redhat: introduce Gemini versioning (Jan Stancek) - redhat: separate RPM version from uname version (Jan Stancek) - redhat: introduce GEMINI and RHEL_REBASE_NUM variable (Jan Stancek) - ipmi: ssif_bmc: Add SSIF BMC driver (Tony Camuso) - common: minor de-dupe of parallel port configs (Peter Robinson) - Fedora 6.3 configs part 1 (Justin M. Forbes) - redhat: configs: Enable CONFIG_MEMTEST to enable memory test (Kate Hsuan) - Update Fedora arm filters after config updates (Nicolas Chauvet) - redhat/kernel.spec.template: Fix kernel-tools-libs-devel dependency (Prarit Bhargava) - redhat: fix the check for the n option (Patrick Talbert) - common: de-dupe some options that are the same (Peter Robinson) - generic: remove deleted options (Peter Robinson) - redhat/configs: enable CONFIG_INTEL_TCC_COOLING for RHEL (David Arcari) - Update Fedora ppc filters after config updates (Justin M. Forbes) - Update Fedora aarch64 filters after config updates (Justin M. Forbes) - fedora: arm: Updates for 6.3 (Peter Robinson) - redhat: kunit: cleanup NITRO config and enable rescale test (Nico Pache) - kernel.spec: use %{package_name} to fix kernel-devel-matched Requires (Jan Stancek) - kernel.spec: use %{package_name} also for abi-stablelist subpackages (Jan Stancek) - kernel.spec: use %{package_name} also for tools subpackages (Jan Stancek) - generic: common: Parport and paride/ata cleanups (Peter Robinson) - CONFIG_SND_SOC_CS42L83 is no longer common (Justin M. Forbes) - configs: arm: bring some configs in line with rhel configs in c9s (Mark Salter) - arm64/configs: Put some arm64 configs in the right place (Mark Salter) - cleanup removed R8188EU config (Peter Robinson) - Make RHJOBS container friendly (Don Zickus) - Remove scmversion from kernel.spec.template (Don Zickus) - redhat/configs: Enable CONFIG_SND_SOC_CS42L83 (Neal Gompa) - Use RHJOBS for create-tarball (Don Zickus) - Enable CONFIG_NET_SCH_FQ_PIE for Fedora (Justin M. Forbes) - Make Fedora debug configs more useful for debug (Justin M. Forbes) - redhat/configs: enable Octeon TX2 network drivers for RHEL (Michal Schmidt) [2040643] - redhat/kernel.spec.template: fix installonlypkg for meta package (Jan Stancek) - redhat: version two of Makefile.rhelver tweaks (Clark Williams) - redhat/configs: Disable CONFIG_GCC_PLUGINS (Prarit Bhargava) - redhat/kernel.spec.template: Fix typo for process_configs.sh call (Neal Gompa) - redhat/configs: CONFIG_CRYPTO_SM3_AVX_X86_64 is x86 only (Vladis Dronov) - redhat/configs: Enable CONFIG_PINCTRL_METEORLAKE in RHEL (Prarit Bhargava) - fedora: enable new image sensors (Peter Robinson) - redhat/self-test: Update self-test data (Prarit Bhargava) - redhat/kernel.spec.template: Fix hardcoded "kernel" (Prarit Bhargava) - redhat/configs/generate_all_configs.sh: Fix config naming (Prarit Bhargava) - redhat/kernel.spec.template: Pass SPECPACKAGE_NAME to generate_all_configs.sh (Prarit Bhargava) - kernel.spec.template: Use SPECPACKAGE_NAME (Prarit Bhargava) - redhat/Makefile: Copy spec file (Prarit Bhargava) - redhat: Change PACKAGE_NAME to SPECPACKAGE_NAME (Prarit Bhargava) - redhat/configs: Support the virtio_mmio.device parameter in Fedora (David Michael) - Revert "Merge branch 'systemd-boot-unsigned' into 'os-build'" (Patrick Talbert) - redhat/Makefile: fix default values for dist-brew's DISTRO and DIST (Íñigo Huguet) - Remove cc lines from automatic configs (Don Zickus) - Add rtla-hwnoise files (Justin M. Forbes) - redhat/kernel.spec.template: Mark it as a non-executable file (Neal Gompa) - fedora: arm: Enable DRM_PANEL_HIMAX_HX8394 (Javier Martinez Canillas) - redhat/configs: CONFIG_HP_ILO location fix (Vladis Dronov) - redhat: Fix build for kselftests mm (Nico Pache) - fix tools build after vm to mm rename (Justin M. Forbes) - redhat/spec: Update bpftool versioning scheme (Viktor Malik) - redhat/configs: CONFIG_CRYPTO_SM4_AESNI_AVX*_X86_64 is x86 only (Prarit Bhargava) - redhat: adapt to upstream Makefile change (Clark Williams) - redhat: modify efiuki specfile changes to use variants convention (Clark Williams) - Turn off DEBUG_INFO_COMPRESSED_ZLIB for Fedora (Justin M. Forbes) - redhat/kernel.spec.template: Fix RHEL systemd-boot-unsigned dependency (Prarit Bhargava) - Add hashtable_test to mod-internal.list (Justin M. Forbes) - Add more kunit tests to mod-internal.list for 6.3 (Justin M. Forbes) - Flip CONFIG_I2C_ALGOBIT to m (Justin M. Forbes) - Flip I2C_ALGOBIT to m to avoid mismatch (Justin M. Forbes) - kernel.spec: move modules.builtin to kernel-core (Jan Stancek) - Turn on IDLE_INJECT for x86 (Justin M. Forbes) - Flip CONFIG_IDLE_INJECT in pending (Justin M. Forbes) - redhat/configs: Enable CONFIG_V4L_TEST_DRIVERS related drivers (Enric Balletbo i Serra) - redhat/configs: Enable UCSI_CCG support (David Marlin) - Fix underline mark-up after text change (Justin M. Forbes) - Turn on CONFIG_XFS_RT for Fedora (Justin M. Forbes) - Consolidate common configs for 6.2 (Justin M. Forbes) - aarch64: enable zboot (Gerd Hoffmann) - redhat: remove duplicate pending-rhel config items (Patrick Talbert) - Disable frame pointers (Justin M. Forbes) - redhat/configs: update scripts and docs for ark -> rhel rename (Clark Williams) - redhat/configs: rename ark configs dir to rhel (Clark Williams) - Turn off CONFIG_DEBUG_INFO_COMPRESSED_ZLIB for ppc64le (Justin M. Forbes) - kernel.spec: package unstripped kselftests/bpf/test_progs (Jan Stancek) - kernel.spec: allow to package some binaries as unstripped (Jan Stancek) - redhat/configs: Make merge.py portable for older python (Desnes Nunes) - Fedora configs for 6.2 (Justin M. Forbes) - redhat: Repair ELN build broken by the recent UKI changes (Vitaly Kuznetsov) - redhat/configs: enable CONFIG_INET_DIAG_DESTROY (Andrea Claudi) - Enable TDX Guest driver (Vitaly Kuznetsov) - redhat/configs: Enable CONFIG_PCIE_PTM generically (Corinna Vinschen) - redhat: Add sub-RPM with a EFI unified kernel image for virtual machines (Vitaly Kuznetsov) - redhat/Makefile: Remove GIT deprecated message (Prarit Bhargava) - Revert "redhat: configs: Disable xtables and ipset" (Phil Sutter) - redhat/configs: Enable CONFIG_SENSORS_LM90 for RHEL (Mark Salter) - Fix up SQUASHFS decompression configs (Justin M. Forbes) - redhat/configs: enable CONFIG_OCTEON_EP as a module in ARK (Michal Schmidt) [2041990] - redhat: ignore rpminspect runpath report on urandom_read selftest binaries (Herton R. Krzesinski) - kernel.spec: add llvm-devel build requirement (Scott Weaver) - Update self-test data to not expect debugbuildsenabled 0 (Justin M. Forbes) - Turn off forced debug builds (Justin M. Forbes) - Turn on debug builds for aarch64 Fedora (Justin M. Forbes) - redhat/configs: modify merge.py to match old overrides input (Clark Williams) - redhat: fixup pylint complaints (Clark Williams) - redhat: remove merge.pl and references to it (Clark Williams) - redhat: update merge.py to handle merge.pl corner cases (Clark Williams) - Revert "redhat: fix elf got hardening for vm tools" (Don Zickus) - Update rebase notes for Fedora (Justin M. Forbes) - Update CONFIG_LOCKDEP_CHAINS_BITS to 19 (cmurf) - redhat/configs: Turn on CONFIG_SPI_TEGRA210_QUAD for RHEL (Mark Salter) - ark: aarch64: drop CONFIG_SMC911X (Peter Robinson) - all: cleanup and de-dupe CDROM_PKTCDVD options. (Peter Robinson) - all: remove CRYPTO_GF128MUL (Peter Robinson) - all: cleanup UEFI options (Peter Robinson) - common: arm64: Enable Ampere Altra SMpro Hardware Monitoring (Peter Robinson) - fedora: enable STACKPROTECTOR_STRONG (Peter Robinson) - fedora: enable STACKPROTECTOR on arm platforms (Peter Robinson) - redhat/self-test: Update data with ENABLE_WERROR (Prarit Bhargava) - redhat/Makefile.variables: Add ENABLE_WERROR (Prarit Bhargava) - makefile: Add -Werror support for RHEL (Prarit Bhargava) - redhat/Makefile.variables: Remove mention of Makefile.rhpkg (Prarit Bhargava) - redhat/Makefile.variables: Alphabetize variables (Prarit Bhargava) - gitlab-ci: use CI templates from production branch (Michael Hofmann) - redhat/kernel.spec.template: Fix internal "File listed twice" errors (Prarit Bhargava) - redhat: Remove stale .tmp_versions code and comments (Prarit Bhargava) - redhat/kernel.spec.template: Fix vmlinux_decompressor on !s390x (Prarit Bhargava) - redhat/kernel.spec.template: Remove unnecessary output from pathfix.py (Prarit Bhargava) - Modularize CONFIG_ARM_CORESIGHT_PMU_ARCH_SYSTEM_PMU (Mark Salter) - redhat/kernel.spec.template: Parallelize compression (Prarit Bhargava) - config: Enable Security Path (Ricardo Robaina) - redhat/self-test/data: Regenerate self-test data for make change (Prarit Bhargava) - Update module filters for nvmem_u-boot-env (Justin M. Forbes) - fedora: Updates for 6.2 merge (Peter Robinson) - fedora: Updates for 6.1 merge (Peter Robinson) - modules-core: use %posttrans (Gerd Hoffmann) - split sub-rpm kernel-modules-core from kernel-core (Gerd Hoffmann) - Turn off CONFIG_MTK_T7XX for S390x (Justin M. Forbes) - CI: add variable for variant handling (Veronika Kabatova) - Fix up configs with SND_SOC_NAU8315 mismatch (Justin M. Forbes) - CI: Do a full build for non-bot runs (Veronika Kabatova) - Fix up configs with SND_SOC_NAU8315 mismatch (Justin M. Forbes) - kernel/rh_messages.c: gcc12 warning on redundant NULL test (Eric Chanudet) [2142658] - redhat/configs: Enable CRYPTO_CURVE25519 in ark (Prarit Bhargava) - general: arm: cleanup ASPEED options (Peter Robinson) - redhat/configs: ALSA - cleanups for the AMD Pink Sardine DMIC driver (Jaroslav Kysela) - redhat/docs: Add FAQ entry for booting between Fedora & ELN/RHEL kernels (Prarit Bhargava) - spec: add missing BuildRequires: python3-docutils for tools (Ondrej Mosnacek) - config: enable RCU_TRACE for debug kernels (Wander Lairson Costa) - Add siphash_kunit and strscpy_kunit to mod-internal.list (Justin M. Forbes) - Add drm_kunit_helpers to mod-internal.list (Justin M. Forbes) - Fix up configs for Fedora so we don't have a mismatch (Justin M. Forbes) - Turn on CONFIG_SQUASHFS_DECOMP_SINGLE in pending (Justin M. Forbes) - redhat/kernel.spec.template: Fix cpupower file error (Prarit Bhargava) - redhat/configs: aarhc64: clean up some erratum configs (Mark Salter) - More Fedora configs for 6.1 as deps were switched on (Justin M. Forbes) - redhat/configs: make SOC_TEGRA_CBB a module (Mark Salter) - redhat/configs: aarch64: reorganize tegra configs to common dir (Mark Salter) - Enforces buildroot if cross_arm (Nicolas Chauvet) - Handle automated case when config generation works correctly (Don Zickus) - Turn off CONFIG_CRYPTO_ARIA_AESNI_AVX_X86_64 (Justin M. Forbes) - Turn off CONFIG_EFI_ZBOOT as it makes CKI choke (Justin M. Forbes) - Fedora config updates for 6.1 (Justin M. Forbes) - redhat: Remove cpupower files (Prarit Bhargava) - redhat/configs: update CXL-related options to match what RHEL will use (John W. Linville) - Clean up the config for the Tegra186 timer (Al Stone) - redhat/configs: move CONFIG_TEGRA186_GPC_DMA config (Mark Salter) - Check for kernel config git-push failures (Don Zickus) - redhat: genlog.sh failures should interrupt the recipe (Patrick Talbert) - Turn CONFIG_GNSS back on for Fedora (Justin M. Forbes) - redhat/configs: enable CONFIG_GNSS for RHEL (Michal Schmidt) - Turn off NVMEM_U_BOOT_ENV for fedora (Justin M. Forbes) - Consolidate matching fedora and ark entries to common (Justin M. Forbes) - Empty out redhat/configs/common (Justin M. Forbes) - Adjust path to compressed vmlinux kernel image for s390x (Justin M. Forbes) [2149273] - Fedora config updates for 6.1 (Justin M. Forbes) - redhat: genlog.sh should expect genlog.py in the current directory (Patrick Talbert) - redhat/configs: consolidate CONFIG_TEST_LIVEPATCH=m (Joe Lawrence) - redhat/configs: enable CONFIG_TEST_LIVEPATCH=m for s390x (Julia Denham) - Revert "Merge branch 'ark-make-help' into 'os-build'" (Scott Weaver) - Remove recommendation to use 'common' for config changes. (Don Zickus) - Update config to add i3c support for AArch64 (Mark Charlebois) - redhat: Move cross-compile scripts into their own directory (Prarit Bhargava) - redhat: Move yaml files into their own directory (Prarit Bhargava) - redhat: Move update_scripts.sh into redhat/scripts (Prarit Bhargava) - redhat: Move kernel-tools scripts into their own directory (Prarit Bhargava) - redhat: Move gen-* scripts into their own directory (Prarit Bhargava) - redhat: Move mod-* scripts into their own directory (Prarit Bhargava) - redhat/Makefile: Fix RHJOBS grep warning (Prarit Bhargava) - redhat: Force remove tmp file (Prarit Bhargava) - redhat/configs: ALSA - cleanups for the CentOS 9.2 update (Jaroslav Kysela) - CI: Use CKI container images from quay.io (Veronika Kabatova) - redhat: clean up the partial-kgcov-snip.config file (Patrick Talbert) - redhat: avoid picking up stray editor backups when processing configs (Clark Williams) - CI: Remove old configs (Veronika Kabatova) - redhat: override `make help` to include dist-help (Jonathan Toppins) - redhat: make RHTEST stricter (Jonathan Toppins) - redhat: Enable support for SN2201 system (Ivan Vecera) - redhat/docs/index.rst: Add FLAVOR information to generate configs for local builds (Enric Balletbo i Serra) - redhat: fix selftest git command so it picks the right commit (Patrick Talbert) - redhat/configs: enable HP_WATCHDOG for aarch64 (Mark Salter) - redhat: disable Kfence Kunit Test (Nico Pache) - configs: enable CONFIG_LRU_GEN_ENABLED everywhere (Patrick Talbert) - redhat: Enable WWAN feature and support for Intel, Qualcomm and Mediatek devices (Jose Ignacio Tornos Martinez) - Turn on dln2 support (RHBZ 2110372) (Justin M. Forbes) - Enable configs for imx8m PHYs (Al Stone) - configs/fedora: Build some SC7180 clock controllers as modules (Javier Martinez Canillas) - redhat/configs: Disable fbdev drivers and use simpledrm everywhere (Javier Martinez Canillas) [1986223] - redhat: fix the branch we pull from the documentation tree (Herton R. Krzesinski) - redhat/configs: change so watchdog is module versus builtin (Steve Best) - redhat/configs: move CONFIG_ACPI_VIDEO to common/generic (Mark Langsdorf) - enable imx8xm I2C configs properly (Al Stone) - configs/fedora: Enable a few more drivers needed by the HP X2 Chromebook (Javier Martinez Canillas) - enable the rtc-rv8803 driver on RHEL and Fedora (David Arcari) - redhat/Makefile: Remove BUILD_SCRATCH_TARGET (Prarit Bhargava) - configs: move CONFIG_INTEL_TDX_GUEST to common directory (Wander Lairson Costa) - redhat/Makefile: Use new BUILD_TARGET for RHEL dist[g]-brew target (Prarit Bhargava) - redhat: method.py: change the output loop to use 'values' method (Patrick Talbert) - redhat: use 'update' method in merge.py (Patrick Talbert) - redhat: Use a context manager in merge.py for opening the config file for reading (Patrick Talbert) - redhat: automatically strip newlines in merge.py (Clark Williams) - redhat: python replacement for merge.pl (Clark Williams) - redhat/docs: Update with DISTLOCALVERSION (Prarit Bhargava) - redhat/Makefile: Rename LOCALVERSION to DISTLOCALVERSION (Akihiko Odaki) - Adjust FIPS module name in RHEL (Vladis Dronov) - spec: prevent git apply from searching for the .git directory (Ondrej Mosnacek) - redhat: Remove parallel_xz.sh (Prarit Bhargava) - Turn on Multi-Gen LRU for Fedora (Justin M. Forbes) - Add kasan_test to mod-internal.list (Justin M. Forbes) - redhat/Makefile.variables: Fix typo with RHDISTGIT_TMP (Prarit Bhargava) - spec: fix path to `installing_core` stamp file for subpackages (Jonathan Lebon) - Remove unused ci scripts (Don Zickus) - Rename rename FORCE_MAX_ZONEORDER to ARCH_FORCE_MAX_ORDER in configs (Justin M. Forbes) - redhat: Add new fortify_kunit & is_signed_type_kunit to mod-internal.list (Patrick Talbert) - Rename rename FORCE_MAX_ZONEORDER to ARCH_FORCE_MAX_ORDER in pending (Justin M. Forbes) - Add acpi video to the filter_modules.sh for rhel (Justin M. Forbes) - Change acpi_bus_get_acpi_device to acpi_get_acpi_dev (Justin M. Forbes) - Turn on ACPI_VIDEO for arm (Justin M. Forbes) - Turn on CONFIG_PRIME_NUMBERS as a module (Justin M. Forbes) - Add new drm kunit tests to mod-internal.list (Justin M. Forbes) - redhat: fix elf got hardening for vm tools (Frantisek Hrbata) - kernel.spec.template: remove some temporary files early (Ondrej Mosnacek) - kernel.spec.template: avoid keeping two copies of vmlinux (Ondrej Mosnacek) - Add fortify_kunit to mod-internal.list (Justin M. Forbes) - Add module filters for Fedora as acpi video has new deps (Justin M. Forbes) - One more mismatch (Justin M. Forbes) - Fix up pending for mismatches (Justin M. Forbes) - Forgot too remove this from pending, it is set properly in ark (Justin M. Forbes) - redhat/Makefile: Add DIST to git tags for RHEL (Prarit Bhargava) - redhat/configs: Move CONFIG_ARM_SMMU_QCOM_DEBUG to common (Jerry Snitselaar) - Common config cleanup for 6.0 (Justin M. Forbes) - Allow selftests to fail without killing the build (Justin M. Forbes) - redhat: Remove redhat/Makefile.rhpkg (Prarit Bhargava) - redhat/Makefile: Move RHDISTGIT_CACHE and RHDISTGIT_TMP (Prarit Bhargava) - redhat/Makefile.rhpkg: Remove RHDISTGIT_USER (Prarit Bhargava) - redhat/Makefile: Move RHPKG_BIN to redhat/Makefile (Prarit Bhargava) - common: clean up Android option with removal of CONFIG_ANDROID (Peter Robinson) - redhat/configs: Remove x86_64 from priority files (Prarit Bhargava) - redhat/configs/pending-ark: Remove x86_64 directory (Prarit Bhargava) - redhat/configs/pending-fedora: Remove x86_64 directory (Prarit Bhargava) - redhat/configs/fedora: Remove x86_64 directory (Prarit Bhargava) - redhat/configs/common: Remove x86_64 directory (Prarit Bhargava) - redhat/configs/ark: Remove x86_64 directory (Prarit Bhargava) - redhat/configs/custom-overrides: Remove x86_64 directory (Prarit Bhargava) - configs: use common CONFIG_ARM64_SME for ark and fedora (Mark Salter) - redhat/configs: Add a warning message to priority.common (Prarit Bhargava) - redhat/configs: Enable INIT_STACK_ALL_ZERO for Fedora (Miko Larsson) - redhat: Set CONFIG_MAXLINEAR_GPHY to =m (Petr Oros) - redhat/configs enable CONFIG_INTEL_IFS (David Arcari) - redhat: Remove filter-i686.sh.rhel (Prarit Bhargava) - redhat/Makefile: Set PATCHLIST_URL to none for RHEL/cs9 (Prarit Bhargava) - redhat: remove GL_DISTGIT_USER, RHDISTGIT and unify dist-git cloning (Prarit Bhargava) - redhat/Makefile.variables: Add ADD_COMMITID_TO_VERSION (Prarit Bhargava) - kernel.spec: disable vmlinux.h generation for s390 zfcpdump config (Prarit Bhargava) - perf: Require libbpf 0.6.0 or newer (Prarit Bhargava) - kabi: add stablelist helpers (Prarit Bhargava) - Makefile: add kabi targets (Prarit Bhargava) - kabi: add support for symbol namespaces into check-kabi (Prarit Bhargava) - kabi: ignore new stablelist metadata in show-kabi (Prarit Bhargava) - redhat/Makefile: add dist-assert-tree-clean target (Prarit Bhargava) - redhat/kernel.spec.template: Specify vmlinux.h path when building samples/bpf (Prarit Bhargava) [2041365] - spec: Fix separate tools build (Prarit Bhargava) [2054579] - redhat/scripts: Update merge-subtrees.sh with new subtree location (Prarit Bhargava) - redhat/kernel.spec.template: enable dependencies generation (Prarit Bhargava) - redhat: build and include memfd to kernel-selftests-internal (Prarit Bhargava) [2027506] - redhat/kernel.spec.template: Link perf with --export-dynamic (Prarit Bhargava) - redhat: kernel.spec: selftests: abort on build failure (Prarit Bhargava) - redhat: configs: move CONFIG_SERIAL_MULTI_INSTANTIATE=m settings to common/x86 (Jaroslav Kysela) - configs: enable CONFIG_HP_ILO for aarch64 (Mark Salter) - all: cleanup dell config options (Peter Robinson) - redhat: Include more kunit tests (Nico Pache) - common: some minor cleanups/de-dupe (Peter Robinson) - common: enable INTEGRITY_MACHINE_KEYRING on all configuraitons (Peter Robinson) - Fedora 6.0 configs update (Justin M. Forbes) - redhat/self-test: Ignore .rhpkg.mk files (Prarit Bhargava) - redhat/configs: Enable CONFIG_PRINTK_INDEX on Fedora (Prarit Bhargava) - redhat/configs: Cleanup CONFIG_X86_KERNEL_IBT (Prarit Bhargava) - Fix up SND_CTL debug options (Justin M. Forbes) - redhat: create /boot symvers link if it doesn't exist (Jan Stancek) - redhat: remove duplicate kunit tests in mod-internal.list (Nico Pache) - configs/fedora: Make Fedora work with HNS3 network adapter (Zamir SUN) - redhat/configs/fedora/generic: Enable CONFIG_BLK_DEV_UBLK on Fedora (Richard W.M. Jones) [2122595] - fedora: disable IWLMEI (Peter Robinson) - redhat/configs: enable UINPUT on aarch64 (Benjamin Tissoires) - Fedora 6.0 configs part 1 (Justin M. Forbes) - redhat/Makefile: Always set UPSTREAM (Prarit Bhargava) - redhat/configs: aarch64: Turn on Apple Silicon configs for Fedora (Eric Curtin) - Add cpumask_kunit to mod-internal.list (Justin M. Forbes) - config - consolidate disabled MARCH options on s390x (Dan Horák) - move the baseline arch to z13 for s390x in F-37+ (Dan Horák) - redhat/scripts/rh-dist-git.sh: Fix outdated cvs reference (Prarit Bhargava) - redhat/scripts/expand_srpm.sh: Use Makefile variables (Prarit Bhargava) - redhat/scripts/clone_tree.sh: Use Makefile variables (Prarit Bhargava) - Fedora: arm changes for 6.0, part 1, with some ACPI (Peter Robinson) - redhat/self-test: Fix shellcheck errors (Prarit Bhargava) - redhat/docs: Add dist-brew BUILD_FLAGS information (Prarit Bhargava) - redhat: change the changelog item for upstream merges (Herton R. Krzesinski) - redhat: fix dist-release build number test (Herton R. Krzesinski) - redhat: fix release number bump when dist-release-changed runs (Herton R. Krzesinski) - redhat: use new genlog.sh script to detect changes for dist-release (Herton R. Krzesinski) - redhat: move changelog addition to the spec file back into genspec.sh (Herton R. Krzesinski) - redhat: always add a rebase entry when ark merges from upstream (Herton R. Krzesinski) - redhat: drop merge ark patches hack (Herton R. Krzesinski) - redhat: don't hardcode temporary changelog file (Herton R. Krzesinski) - redhat: split changelog generation from genspec.sh (Herton R. Krzesinski) - redhat: configs: Disable FIE on arm (Jeremy Linton) [2012226] - redhat/Makefile: Clean linux tarballs (Prarit Bhargava) - redhat/configs: Cleanup CONFIG_ACPI_AGDI (Prarit Bhargava) - spec: add cpupower daemon reload on install/upgrade (Jarod Wilson) - redhat: properly handle binary files in patches (Ondrej Mosnacek) - Add python3-setuptools buildreq for perf (Justin M. Forbes) - Add cros_kunit to mod-internal.list (Justin M. Forbes) - Add new tests to mod-internal.list (Justin M. Forbes) - Turn off some Kunit tests in pending (Justin M. Forbes) - Clean up a mismatch in Fedora configs (Justin M. Forbes) - redhat/configs: Sync up Retbleed configs with centos-stream (Waiman Long) - Change CRYPTO_BLAKE2S_X86 from m to y (Justin M. Forbes) - Leave CONFIG_ACPI_VIDEO on for x86 only (Justin M. Forbes) - Fix BLAKE2S_ARM and BLAKE2S_X86 configs in pending (Justin M. Forbes) - Fix pending for ACPI_VIDEO (Justin M. Forbes) - redhat/configs: Fix rm warning on config warnings (Eric Chanudet) - redhat/Makefile: Deprecate PREBUILD_GIT_ONLY variable (Prarit Bhargava) - redhat/Makefile: Deprecate SINGLE_TARBALL variable (Prarit Bhargava) - redhat/Makefile: Deprecate GIT variable (Prarit Bhargava) - Update CONFIG_LOCKDEP_CHAINS_BITS to 18 (cmurf) - Add new FIPS module name and version configs (Vladis Dronov) - redhat/configs/fedora: Make PowerPC's nx-gzip buildin (Jakub Čajka) - omit unused Provides (Dan Horák) - self-test: Add test for DIST=".eln" (Prarit Bhargava) - redhat: Enable CONFIG_LZ4_COMPRESS on Fedora (Prarit Bhargava) - fedora: armv7: enable MMC_STM32_SDMMC (Peter Robinson) - .gitlab-ci.yaml: Add test for dist-get-buildreqs target (Prarit Bhargava) - redhat/docs: Add information on build dependencies (Prarit Bhargava) - redhat/Makefile: Add better pass message for dist-get-buildreqs (Prarit Bhargava) - redhat/Makefile: Provide a better message for system-sb-certs (Prarit Bhargava) - redhat/Makefile: Change dist-buildreq-check to a non-blocking target (Prarit Bhargava) - create-data: Parallelize spec file data (Prarit Bhargava) - create-data.sh: Store SOURCES Makefile variable (Prarit Bhargava) - redhat/Makefile: Split up setup-source target (Prarit Bhargava) - create-data.sh: Redefine varfilename (Prarit Bhargava) - create-data.sh: Parallelize variable file creation (Prarit Bhargava) - redhat/configs: Enable CONFIG_LZ4_COMPRESS (Prarit Bhargava) - redhat/docs: Update brew information (Prarit Bhargava) - redhat/Makefile: Fix eln BUILD_TARGET (Prarit Bhargava) - redhat/Makefile: Set BUILD_TARGET for dist-brew (Prarit Bhargava) - kernel.spec.template: update (s390x) expoline.o path (Joe Lawrence) - fedora: enable BCM_NET_PHYPTP (Peter Robinson) - Fedora 5.19 configs update part 2 (Justin M. Forbes) - redhat/Makefile: Change fedora BUILD_TARGET (Prarit Bhargava) - New configs in security/keys (Fedora Kernel Team) - Fedora: arm: enable a pair of drivers (Peter Robinson) - redhat: make kernel-zfcpdump-core to not provide kernel-core/kernel (Herton R. Krzesinski) - redhat/configs: Enable QAT devices for arches other than x86 (Vladis Dronov) - Fedora 5.19 configs pt 1 (Justin M. Forbes) - redhat: Exclude cpufreq.h from kernel-headers (Patrick Talbert) - Add rtla subpackage for kernel-tools (Justin M. Forbes) - fedora: arm: enable a couple of QCom drivers (Peter Robinson) - redhat/Makefile: Deprecate BUILD_SCRATCH_TARGET (Prarit Bhargava) - redhat: enable CONFIG_DEVTMPFS_SAFE (Mark Langsdorf) - redhat/Makefile: Remove deprecated variables and targets (Prarit Bhargava) - Split partner modules into a sub-package (Alice Mitchell) - Enable kAFS and it's dependancies in RHEL (Alice Mitchell) - Enable Marvell OcteonTX2 crypto device in ARK (Vladis Dronov) - redhat/Makefile: Remove --scratch from BUILD_TARGET (Prarit Bhargava) - redhat/Makefile: Fix dist-brew and distg-brew targets (Prarit Bhargava) - fedora: arm64: Initial support for TI Keystone 3 (ARCH_K3) (Peter Robinson) - fedora: arm: enable Hardware Timestamping Engine support (Peter Robinson) - fedora: wireless: disable SiLabs and PureLiFi (Peter Robinson) - fedora: updates for 5.19 (Peter Robinson) - fedora: minor updates for Fedora configs (Peter Robinson) - configs/fedora: Enable the pinctrl SC7180 driver built-in (Enric Balletbo i Serra) - redhat/configs: enable CONFIG_DEBUG_NET for debug kernel (Hangbin Liu) - redhat/Makefile: Add SPECKABIVERSION variable (Prarit Bhargava) - redhat/self-test: Provide better failure output (Prarit Bhargava) - redhat/self-test: Reformat tests to kernel standard (Prarit Bhargava) - redhat/self-test: Add purpose and header to each test (Prarit Bhargava) - Drop outdated CRYPTO_ECDH configs (Vladis Dronov) - Brush up crypto SHA512 and USER configs (Vladis Dronov) - Brush up crypto ECDH and ECDSA configs (Vladis Dronov) - redhat/self-test: Update data set (Prarit Bhargava) - create-data.sh: Reduce specfile data output (Prarit Bhargava) - redhat/configs: restore/fix core INTEL_LPSS configs to be builtin again (Hans de Goede) - Enable CKI on os-build MRs only (Don Zickus) - self-test: Fixup Makefile contents test (Prarit Bhargava) - redhat/self-test: self-test data update (Prarit Bhargava) - redhat/self-test: Fix up create-data.sh to not report local variables (Prarit Bhargava) - redhat/configs/fedora: Enable a set of modules used on some x86 tablets (Hans de Goede) - redhat/configs: Make INTEL_SOC_PMIC_CHTDC_TI builtin (Hans de Goede) - redhat/configs/fedora: enable missing modules modules for Intel IPU3 camera support (Hans de Goede) - Common: minor cleanups (Peter Robinson) - fedora: some minor Fedora cleanups (Peter Robinson) - fedora: drop X86_PLATFORM_DRIVERS_DELL dupe (Peter Robinson) - redhat: change tools_make macro to avoid full override of variables in Makefile (Herton R. Krzesinski) - Fix typo in Makefile for Fedora Stable Versioning (Justin M. Forbes) - Remove duplicates from ark/generic/s390x/zfcpdump/ (Vladis Dronov) - Move common/debug/s390x/zfcpdump/ configs to ark/debug/s390x/zfcpdump/ (Vladis Dronov) - Move common/generic/s390x/zfcpdump/ configs to ark/generic/s390x/zfcpdump/ (Vladis Dronov) - Drop RCU_EXP_CPU_STALL_TIMEOUT to 0, we are not really android (Justin M. Forbes) - redhat/configs/README: Update the README (Prarit Bhargava) - redhat/docs: fix hyperlink typo (Patrick Talbert) - all: net: remove old NIC/ATM drivers that use virt_to_bus() (Peter Robinson) - Explicitly turn off CONFIG_KASAN_INLINE for ppc (Justin M. Forbes) - redhat/docs: Add a description of kernel naming (Prarit Bhargava) - Change CRYPTO_CHACHA_S390 from m to y (Justin M. Forbes) - enable CONFIG_NET_ACT_CTINFO in ark (Davide Caratti) - redhat/configs: enable CONFIG_SP5100_TCO (David Arcari) - redhat/configs: Set CONFIG_VIRTIO_IOMMU on x86_64 (Eric Auger) [2089765] - Turn off KASAN_INLINE for RHEL ppc in pending (Justin M. Forbes) - redhat/kernel.spec.template: update selftest data via "make dist-self-test-data" (Denys Vlasenko) - redhat/kernel.spec.template: remove stray *.hardlink-temporary files, if any (Denys Vlasenko) - Fix up ZSMALLOC config for s390 (Justin M. Forbes) - Turn on KASAN_OUTLINE for ppc debug (Justin M. Forbes) - Turn on KASAN_OUTLINE for PPC debug to avoid mismatch (Justin M. Forbes) - Fix up crypto config mistmatches (Justin M. Forbes) - Fix up config mismatches (Justin M. Forbes) - generic/fedora: cleanup and disable Lightning Moutain SoC (Peter Robinson) - redhat: Set SND_SOC_SOF_HDA_PROBES to =m (Patrick Talbert) - Fix versioning on stable Fedora (Justin M. Forbes) - Enable PAGE_POOL_STATS for arm only (Justin M. Forbes) - Revert "Merge branch 'fix-ci-20220523' into 'os-build'" (Patrick Talbert) - Flip CONFIG_RADIO_ADAPTERS to module for Fedora (Justin M. Forbes) - redhat/Makefile: Drop quotation marks around string definitions (Prarit Bhargava) - Fedora: arm: Updates for QCom devices (Peter Robinson) - Fedora arm and generic updates for 5.17 (Peter Robinson) - enable COMMON_CLK_SI5341 for Xilinx ZYNQ-MP (Peter Robinson) - Turn on CONFIG_DM_VERITY_VERIFY_ROOTHASH_SIG_SECONDARY_KEYRING for Fedora (Justin M. Forbes) - redhat/self-test/data: Update data set (Prarit Bhargava) - Revert variable switch for lasttag (Justin M. Forbes) - redhat: Add self-tests to .gitlab-ci.yml (Prarit Bhargava) - redhat/self-test: Update data (Prarit Bhargava) - redhat/self-test: Unset Makefile variables (Prarit Bhargava) - redhat/self-test: Omit SHELL variable from test data (Prarit Bhargava) - Add CONFIG_EFI_DXE_MEM_ATTRIBUTES (Justin M. Forbes) - Update filter-modules for mlx5-vfio-pci (Justin M. Forbes) - Fedora configs for 5.18 (Justin M. Forbes) - self-test/data/create-data.sh: Avoid SINGLE_TARBALL warning (Prarit Bhargava) - redhat/Makefile: Rename PREBUILD to UPSTREAMBUILD (Prarit Bhargava) - redhat/Makefile: Rename BUILDID to LOCALVERSION (Prarit Bhargava) - redhat/Makefile: Fix dist-brew & distg-brew targets (Prarit Bhargava) - redhat/Makefile: Reorganize MARKER code (Prarit Bhargava) - redhat/scripts/new_release.sh: Use Makefile variables (Prarit Bhargava) - redhat/Makefile: Rename __YSTREAM and __ZSTREAM (Prarit Bhargava) - redhat/genspec.sh: Add comment about SPECBUILDID variable (Prarit Bhargava) - redhat/kernel.spec.template: Move genspec variables into one section (Prarit Bhargava) - redhat/kernel.spec.template: Remove kversion (Prarit Bhargava) - redhat/Makefile: Add SPECTARFILE_RELEASE comment (Prarit Bhargava) - redhat/Makefile: Rename RPMVERSION to BASEVERSION (Prarit Bhargava) - redhat/Makefile: Target whitespace cleanup (Prarit Bhargava) - redhat/Makefile: Move SPECRELEASE to genspec.sh (Prarit Bhargava) - redhat/Makefile: Add kernel-NVR comment (Prarit Bhargava) - redhat/Makefile: Use SPECFILE variable (Prarit Bhargava) - redhat/Makefile: Remove KEXTRAVERSION (Prarit Bhargava) - redhat: Enable VM kselftests (Nico Pache) [1978539] - redhat: enable CONFIG_TEST_VMALLOC for vm selftests (Nico Pache) - redhat: Enable HMM test to be used by the kselftest test suite (Nico Pache) - redhat/Makefile.variables: Change git hash length to default (Prarit Bhargava) - redhat/Makefile: Drop quotation marks around string definitions (Prarit Bhargava) - Turn on INTEGRITY_MACHINE_KEYRING for Fedora (Justin M. Forbes) - redhat/configs: fix CONFIG_INTEL_ISHTP_ECLITE (David Arcari) - redhat/configs: Fix rm warning on error (Prarit Bhargava) - Fix nightly merge CI (Don Zickus) - redhat/kernel.spec.template: fix standalone tools build (Jan Stancek) - Add system-sb-certs for RHEL-9 (Don Zickus) - Fix dist-buildcheck-reqs (Don Zickus) - move DAMON configs to correct directory (Chris von Recklinghausen) - redhat: indicate HEAD state in tarball/rpm name (Jarod Wilson) - Fedora 5.18 config set part 1 (Justin M. Forbes) - fedora: arm: Enable new Rockchip 356x series drivers (Peter Robinson) - fedora: arm: enable DRM_I2C_NXP_TDA998X on aarch64 (Peter Robinson) - redhat/self-test: Add test to verify Makefile declarations. (Prarit Bhargava) - redhat/Makefile: Add RHTEST (Prarit Bhargava) - redhat: shellcheck cleanup (Prarit Bhargava) - redhat/self-test/data: Cleanup data (Prarit Bhargava) - redhat/self-test: Add test to verify SPEC variables (Prarit Bhargava) - redhat/Makefile: Add 'duplicate' SPEC entries for user set variables (Prarit Bhargava) - redhat/Makefile: Rename TARFILE_RELEASE to SPECTARFILE_RELEASE (Prarit Bhargava) - redhat/genspec: Rename PATCHLIST_CHANGELOG to SPECPATCHLIST_CHANGELOG (Prarit Bhargava) - redhat/genspec: Rename DEBUG_BUILDS_ENABLED to SPECDEBUG_BUILDS_ENABLED (Prarit Bhargava) - redhat/Makefile: Rename PKGRELEASE to SPECBUILD (Prarit Bhargava) - redhat/genspec: Rename BUILDID_DEFINE to SPECBUILDID (Prarit Bhargava) - redhat/Makefile: Rename CHANGELOG to SPECCHANGELOG (Prarit Bhargava) - redhat/Makefile: Rename RPMKEXTRAVERSION to SPECKEXTRAVERSION (Prarit Bhargava) - redhat/Makefile: Rename RPMKSUBLEVEL to SPECKSUBLEVEL (Prarit Bhargava) - redhat/Makefile: Rename RPMKPATCHLEVEL to SPECKPATCHLEVEL (Prarit Bhargava) - redhat/Makefile: Rename RPMKVERSION to SPECKVERSION (Prarit Bhargava) - redhat/Makefile: Rename KVERSION to SPECVERSION (Prarit Bhargava) - redhat/Makefile: Deprecate some simple targets (Prarit Bhargava) - redhat/Makefile: Use KVERSION (Prarit Bhargava) - redhat/configs: Set GUP_TEST in debug kernel (Joel Savitz) - enable DAMON configs (Chris von Recklinghausen) [2004233] - redhat: add zstream switch for zstream release numbering (Herton R. Krzesinski) - redhat: change kabi tarballs to use the package release (Herton R. Krzesinski) - redhat: generate distgit changelog in genspec.sh as well (Herton R. Krzesinski) - redhat: make genspec prefer metadata from git notes (Herton R. Krzesinski) - redhat: use tags from git notes for zstream to generate changelog (Herton R. Krzesinski) - ARK: Remove code marking devices unmaintained (Peter Georg) - rh_message: Fix function name (Peter Georg) [2019377] - Turn on CONFIG_RANDOM_TRUST_BOOTLOADER (Justin M. Forbes) - redhat/configs: aarch64: enable CPU_FREQ_GOV_SCHEDUTIL (Mark Salter) - Move CONFIG_HW_RANDOM_CN10K to a proper place (Vladis Dronov) - redhat/self-test: Clean up data set (Prarit Bhargava) - redhat/Makefile.rhpkg: Remove quotes for RHDISTGIT (Prarit Bhargava) - redhat/scripts/create-tarball.sh: Use Makefile variables (Prarit Bhargava) - redhat/Makefile: Deprecate SINGLE_TARBALL (Prarit Bhargava) - redhat/Makefile: Move SINGLE_TARBALL to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Use RPMVERSION (Prarit Bhargava) - redhat/scripts/rh-dist-git.sh: Use Makefile variables (Prarit Bhargava) - redhat/configs/build_configs.sh: Use Makefile variables (Prarit Bhargava) - redhat/configs/process_configs.sh: Use Makefile variables (Prarit Bhargava) - redhat/kernel.spec.template: Use RPM_BUILD_NCPUS (Prarit Bhargava) - redhat/configs/generate_all_configs.sh: Use Makefile variables (Prarit Bhargava) - redhat/configs: enable nf_tables SYNPROXY extension on ark (Davide Caratti) - fedora: Disable fbdev drivers missed before (Javier Martinez Canillas) - Redhat: enable Kfence on production servers (Nico Pache) - redhat: ignore known empty patches on the patches rpminspect test (Herton R. Krzesinski) - kernel-ark: arch_hw Update CONFIG_MOUSE_VSXXXAA=m (Tony Camuso) [2062909] - spec: keep .BTF section in modules for s390 (Yauheni Kaliuta) [2071969] - kernel.spec.template: Ship arch/s390/lib/expoline.o in kernel-devel (Ondrej Mosnacek) - redhat: disable tv/radio media device infrastructure (Jarod Wilson) - redhat/configs: clean up INTEL_LPSS configuration (David Arcari) - Have to rename the actual contents too (Justin M. Forbes) - The CONFIG_SATA_MOBILE_LPM_POLICY rebane was reverted (Justin M. Forbes) - redhat: Enable KASAN on all ELN debug kernels (Nico Pache) - redhat: configs: Enable INTEL_IOMMU_DEBUGFS for debug builds (Jerry Snitselaar) - generic: can: disable CAN_SOFTING everywhere (Peter Robinson) - redhat/configs: Enable CONFIG_DM_ERA=m for all (Yanko Kaneti) - redhat/configs: enable CONFIG_SAMPLE_VFIO_MDEV_MTTY (Patrick Talbert) - Build intel_sdsi with %{tools_make} (Justin M. Forbes) - configs: remove redundant Fedora config for INTEL_IDXD_COMPAT (Jerry Snitselaar) - redhat/configs: enable CONFIG_RANDOMIZE_KSTACK_OFFSET_DEFAULT (Joel Savitz) [2026319] - configs: enable CONFIG_RMI4_F3A (Benjamin Tissoires) - redhat: configs: Disable TPM 1.2 specific drivers (Jerry Snitselaar) - redhat/configs: Enable cr50 I2C TPM interface (Akihiko Odaki) - spec: make HMAC file encode relative path (Jonathan Lebon) - redhat/kernel.spec.template: Add intel_sdsi utility (Prarit Bhargava) - Spec fixes for intel-speed-select (Justin M. Forbes) - Add Partner Supported taint flag to kAFS (Alice Mitchell) [2038999] - Add Partner Supported taint flag (Alice Mitchell) [2038999] - Enabled INTEGRITY_MACHINE_KEYRING for all configs. (Peter Robinson) - redhat/configs: Enable CONFIG_RCU_SCALE_TEST & CONFIG_RCU_REF_SCALE_TEST (Waiman Long) - Add clk_test and clk-gate_test to mod-internal.list (Justin M. Forbes) - redhat/self-tests: Ignore UPSTREAM (Prarit Bhargava) - redhat/self-tests: Ignore RHGITURL (Prarit Bhargava) - redhat/Makefile.variables: Extend git hash length to 15 (Prarit Bhargava) - redhat/self-test: Remove changelog from spec files (Prarit Bhargava) - redhat/genspec.sh: Rearrange genspec.sh (Prarit Bhargava) - redhat/self-test: Add spec file data (Prarit Bhargava) - redhat/self-test: Add better dist-dump-variables test (Prarit Bhargava) - redhat/self-test: Add variable test data (Prarit Bhargava) - redhat/config: Remove obsolete CONFIG_MFD_INTEL_PMT (David Arcari) - redhat/configs: enable CONFIG_INTEL_ISHTP_ECLITE (David Arcari) - Avoid creating files in $RPM_SOURCE_DIR (Nicolas Chauvet) - Flip CRC64 from off to y (Justin M. Forbes) - New configs in lib/Kconfig (Fedora Kernel Team) - disable redundant assignment of CONFIG_BQL on ARK (Davide Caratti) - redhat/configs: remove unnecessary GPIO options for aarch64 (Brian Masney) - redhat/configs: remove viperboard related Kconfig options (Brian Masney) - redhat/configs/process_configs.sh: Avoid race with find (Prarit Bhargava) - redhat/configs/process_configs.sh: Remove CONTINUEONERROR (Prarit Bhargava) - Remove i686 configs and filters (Justin M. Forbes) - redhat/configs: Set CONFIG_X86_AMD_PSTATE built-in on Fedora (Prarit Bhargava) - Fix up mismatch with CRC64 (Justin M. Forbes) - Fedora config updates to fix process_configs (Justin M. Forbes) - redhat: Fix release tagging (Prarit Bhargava) - redhat/self-test: Fix version tag test (Prarit Bhargava) - redhat/self-test: Fix BUILD verification test (Prarit Bhargava) - redhat/self-test: Cleanup SRPM related self-tests (Prarit Bhargava) - redhat/self-test: Fix shellcheck test (Prarit Bhargava) - redhat/configs: Disable watchdog components (Prarit Bhargava) - redhat/README.Makefile: Add a Makefile README file (Prarit Bhargava) - redhat/Makefile: Remove duplicated code (Prarit Bhargava) - Add BuildRequires libnl3-devel for intel-speed-select (Justin M. Forbes) - Add new kunit tests for 5.18 to mod-internal.list (Justin M. Forbes) - Fix RHDISTGIT for Fedora (Justin M. Forbes) - redhat/configs/process_configs.sh: Fix race with tools generation (Prarit Bhargava) - New configs in drivers/dax (Fedora Kernel Team) - Fix up CONFIG_SND_AMD_ACP_CONFIG files (Patrick Talbert) - Remove CONFIG_SND_SOC_SOF_DEBUG_PROBES files (Patrick Talbert) - SATA_MOBILE_LPM_POLICY is now SATA_LPM_POLICY (Justin M. Forbes) - Define SNAPSHOT correctly when VERSION_ON_UPSTREAM is 0 (Justin M. Forbes) - redhat/Makefile: Fix dist-git (Prarit Bhargava) - Change the pending-ark CONFIG_DAX to y due to mismatch (Justin M. Forbes) - Enable net reference count trackers in all debug kernels (Jiri Benc) - redhat/Makefile: Reorganize variables (Prarit Bhargava) - redhat/Makefile: Add some descriptions (Prarit Bhargava) - redhat/Makefile: Move SNAPSHOT check (Prarit Bhargava) - redhat/Makefile: Deprecate BREW_FLAGS, KOJI_FLAGS, and TEST_FLAGS (Prarit Bhargava) - redhat/genspec.sh: Rework RPMVERSION variable (Prarit Bhargava) - redhat/Makefile: Remove dead comment (Prarit Bhargava) - redhat/Makefile: Cleanup KABI* variables. (Prarit Bhargava) - redhat/Makefile.variables: Default RHGITCOMMIT to HEAD (Prarit Bhargava) - redhat/scripts/create-tarball.sh: Use Makefile TARBALL variable (Prarit Bhargava) - redhat/Makefile: Remove extra DIST_BRANCH (Prarit Bhargava) - redhat/Makefile: Remove STAMP_VERSION (Prarit Bhargava) - redhat/Makefile: Move NO_CONFIGCHECKS to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move RHJOBS to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move RHGIT* variables to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move PREBUILD_GIT_ONLY to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move BUILD to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move BUILD_FLAGS to Makefile.variables. (Prarit Bhargava) - redhat/Makefile: Move BUILD_PROFILE to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move BUILD_TARGET and BUILD_SCRATCH_TARGET to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Remove RHPRODUCT variable (Prarit Bhargava) - redhat/Makefile: Cleanup DISTRO variable (Prarit Bhargava) - redhat/Makefile: Move HEAD to Makefile.variables. (Prarit Bhargava) - redhat: Combine Makefile and Makefile.common (Prarit Bhargava) - redhat/koji/Makefile: Decouple koji Makefile from Makefile.common (Prarit Bhargava) - Set CONFIG_SND_SOC_SOF_MT8195 for Fedora and turn on VDPA_SIM_BLOCK (Justin M. Forbes) - Add asus_wmi_sensors modules to filters for Fedora (Justin M. Forbes) - redhat: spec: trigger dracut when modules are installed separately (Jan Stancek) - Last of the Fedora 5.17 configs initial pass (Justin M. Forbes) - redhat/Makefile: Silence dist-clean-configs output (Prarit Bhargava) - Fedora 5.17 config updates (Justin M. Forbes) - Setting CONFIG_I2C_SMBUS to "m" for ark (Gopal Tiwari) - Print arch with process_configs errors (Justin M. Forbes) - Pass RHJOBS to process_configs for dist-configs-check as well (Justin M. Forbes) - redhat/configs/process_configs.sh: Fix issue with old error files (Prarit Bhargava) - redhat/configs/build_configs.sh: Parallelize execution (Prarit Bhargava) - redhat/configs/build_configs.sh: Provide better messages (Prarit Bhargava) - redhat/configs/build_configs.sh: Create unique output files (Prarit Bhargava) - redhat/configs/build_configs.sh: Add local variables (Prarit Bhargava) - redhat/configs/process_configs.sh: Parallelize execution (Prarit Bhargava) - redhat/configs/process_configs.sh: Provide better messages (Prarit Bhargava) - redhat/configs/process_configs.sh: Create unique output files (Prarit Bhargava) - redhat/configs/process_configs.sh: Add processing config function (Prarit Bhargava) - redhat: Unify genspec.sh and kernel.spec variable names (Prarit Bhargava) - redhat/genspec.sh: Remove options and use Makefile variables (Prarit Bhargava) - Add rebase note for 5.17 on Fedora stable (Justin M. Forbes) - More Fedora config updates for 5.17 (Justin M. Forbes) - redhat/configs: Disable CONFIG_MACINTOSH_DRIVERS in RHEL. (Prarit Bhargava) - redhat: Fix "make dist-release-finish" to use the correct NVR variables (Neal Gompa) [2053836] - Build CROS_EC Modules (Jason Montleon) - redhat: configs: change aarch64 default dma domain to lazy (Jerry Snitselaar) - redhat: configs: disable ATM protocols (Davide Caratti) - configs/fedora: Enable the interconnect SC7180 driver built-in (Enric Balletbo i Serra) - configs: clean up CONFIG_PAGE_TABLE_ISOLATION files (Ondrej Mosnacek) - redhat: configs: enable CONFIG_INTEL_PCH_THERMAL for RHEL x86 (David Arcari) - redhat/Makefile: Fix dist-dump-variables target (Prarit Bhargava) - redhat/configs: Enable DEV_DAX and DEV_DAX_PMEM modules on aarch64 for fedora (D Scott Phillips) - redhat/configs: Enable CONFIG_TRANSPARENT_HUGEPAGE on aarch64 for fedora (D Scott Phillips) - configs/process_configs.sh: Remove orig files (Prarit Bhargava) - redhat: configs: Disable CONFIG_MPLS for s390x/zfcpdump (Guillaume Nault) - Fedora 5.17 configs round 1 (Justin M. Forbes) - redhat: configs: disable the surface platform (David Arcari) - redhat: configs: Disable team driver (Hangbin Liu) [1945477] - configs: enable LOGITECH_FF for RHEL/CentOS too (Benjamin Tissoires) - redhat/configs: Disable CONFIG_SENSORS_NCT6683 in RHEL for arm/aarch64 (Dean Nelson) [2041186] - redhat: fix make {distg-brew,distg-koji} (Andrea Claudi) - [fedora] Turn on CONFIG_VIDEO_OV5693 for sensor support (Dave Olsthoorn) - Cleanup 'disabled' config options for RHEL (Prarit Bhargava) - redhat: move CONFIG_ARM64_MTE to aarch64 config directory (Herton R. Krzesinski) - Change CONFIG_TEST_BPF to a module (Justin M. Forbes) - Change CONFIG_TEST_BPF to module in pending MR coming for proper review (Justin M. Forbes) - redhat/configs: Enable CONFIG_TEST_BPF (Viktor Malik) - Enable KUNIT tests for testing (Nico Pache) - Makefile: Check PKGRELEASE size on dist-brew targets (Prarit Bhargava) - kernel.spec: Add glibc-static build requirement (Prarit Bhargava) - Enable iSER on s390x (Stefan Schulze Frielinghaus) - redhat/configs: Enable CONFIG_ACER_WIRELESS (Peter Georg) [2025985] - kabi: Add kABI macros for enum type (Čestmír Kalina) [2024595] - kabi: expand and clarify documentation of aux structs (Čestmír Kalina) [2024595] - kabi: introduce RH_KABI_USE_AUX_PTR (Čestmír Kalina) [2024595] - kabi: rename RH_KABI_SIZE_AND_EXTEND to AUX (Čestmír Kalina) [2024595] - kabi: more consistent _RH_KABI_SIZE_AND_EXTEND (Čestmír Kalina) [2024595] - kabi: use fixed field name for extended part (Čestmír Kalina) [2024595] - kabi: fix dereference in RH_KABI_CHECK_EXT (Čestmír Kalina) [2024595] - kabi: fix RH_KABI_SET_SIZE macro (Čestmír Kalina) [2024595] - kabi: expand and clarify documentation (Čestmír Kalina) [2024595] - kabi: make RH_KABI_USE replace any number of reserved fields (Čestmír Kalina) [2024595] - kabi: rename RH_KABI_USE2 to RH_KABI_USE_SPLIT (Čestmír Kalina) [2024595] - kabi: change RH_KABI_REPLACE2 to RH_KABI_REPLACE_SPLIT (Čestmír Kalina) [2024595] - kabi: change RH_KABI_REPLACE_UNSAFE to RH_KABI_BROKEN_REPLACE (Čestmír Kalina) [2024595] - kabi: introduce RH_KABI_ADD_MODIFIER (Čestmír Kalina) [2024595] - kabi: Include kconfig.h (Čestmír Kalina) [2024595] - kabi: macros for intentional kABI breakage (Čestmír Kalina) [2024595] - kabi: fix the note about terminating semicolon (Čestmír Kalina) [2024595] - kabi: introduce RH_KABI_HIDE_INCLUDE and RH_KABI_FAKE_INCLUDE (Čestmír Kalina) [2024595] - spec: don't overwrite auto.conf with .config (Ondrej Mosnacek) - New configs in drivers/crypto (Fedora Kernel Team) - Add test_hash to the mod-internal.list (Justin M. Forbes) - configs: disable CONFIG_CRAMFS (Abhi Das) [2041184] - spec: speed up "cp -r" when it overwrites existing files. (Denys Vlasenko) - redhat: use centos x509.genkey file if building under centos (Herton R. Krzesinski) - Revert "[redhat] Generate a crashkernel.default for each kernel build" (Coiby Xu) - spec: make linux-firmware weak(er) dependency (Jan Stancek) - rtw89: enable new driver rtw89 and device RTK8852AE (Íñigo Huguet) - Config consolidation into common (Justin M. Forbes) - Add packaged but empty /lib/modules//systemtap/ (Justin M. Forbes) - filter-modules.sh.rhel: Add ntc_thermistor to singlemods (Prarit Bhargava) - Move CONFIG_SND_SOC_TLV320AIC31XX as it is now selected by CONFIG_SND_SOC_FSL_ASOC_CARD (Justin M. Forbes) - Add dev_addr_lists_test to mod-internal.list (Justin M. Forbes) - configs/fedora: Enable CONFIG_NFC_PN532_UART for use PN532 NFC module (Ziqian SUN (Zamir)) - redhat: ignore ksamples and kselftests on the badfuncs rpminspect test (Herton R. Krzesinski) - redhat: disable upstream check for rpminspect (Herton R. Krzesinski) - redhat: switch the vsyscall config to CONFIG_LEGACY_VSYSCALL_XONLY=y (Herton R. Krzesinski) [1876977] - redhat: configs: increase CONFIG_DEBUG_KMEMLEAK_MEM_POOL_SIZE (Rafael Aquini) - move CONFIG_STRICT_SIGALTSTACK_SIZE to the appropriate directory (David Arcari) - redhat/configs: Enable CONFIG_DM_MULTIPATH_IOA for fedora (Benjamin Marzinski) - redhat/configs: Enable CONFIG_DM_MULTIPATH_HST (Benjamin Marzinski) [2000835] - redhat: Pull in openssl-devel as a build dependency correctly (Neal Gompa) [2034670] - redhat/configs: Migrate ZRAM_DEF_* configs to common/ (Neal Gompa) - redhat/configs: Enable CONFIG_CRYPTO_ZSTD (Neal Gompa) [2032758] - Turn CONFIG_DEVMEM back off for aarch64 (Justin M. Forbes) - Clean up excess text in Fedora config files (Justin M. Forbes) - Fedora config updates for 5.16 (Justin M. Forbes) - redhat/configs: enable CONFIG_INPUT_KEYBOARD for AARCH64 (Vitaly Kuznetsov) - Fedora configs for 5.16 pt 1 (Justin M. Forbes) - redhat/configs: NFS: disable UDP, insecure enctypes (Benjamin Coddington) [1952863] - Update rebase-notes with dracut 5.17 information (Justin M. Forbes) - redhat/configs: Enable CONFIG_CRYPTO_BLAKE2B (Neal Gompa) [2031547] - Enable CONFIG_BPF_SYSCALL for zfcpdump (Jiri Olsa) - Enable CONFIG_CIFS_SMB_DIRECT for ARK (Ronnie Sahlberg) - mt76: enable new device MT7921E in CentOs/RHEL (Íñigo Huguet) [2004821] - Disable CONFIG_DEBUG_PREEMPT on normal builds (Phil Auld) - redhat/configs: Enable CONFIG_PCI_P2PDMA for ark (Myron Stowe) - pci.h: Fix static include (Prarit Bhargava) - Enable CONFIG_VFIO_NOIOMMU for Fedora (Justin M. Forbes) - redhat/configs: enable CONFIG_NTB_NETDEV for ark (John W. Linville) - drivers/pci/pci-driver.c: Fix if/ifdef typo (Prarit Bhargava) - common: arm64: ensure all the required arm64 errata are enabled (Peter Robinson) - kernel/rh_taint.c: Update to new messaging (Prarit Bhargava) [2019377] - redhat/configs: enable CONFIG_AMD_PTDMA for ark (John W. Linville) - redhat/configs: enable CONFIG_RD_ZSTD for rhel (Tao Liu) [2020132] - fedora: build TEE as a module for all arches (Peter Robinson) - common: build TRUSTED_KEYS in everywhere (Peter Robinson) - redhat: make Patchlist.changelog generation conditional (Herton R. Krzesinski) - redhat/configs: Add two new CONFIGs (Prarit Bhargava) - redhat/configs: Remove dead CONFIG files (Prarit Bhargava) - redhat/configs/evaluate_configs: Add find dead configs option (Prarit Bhargava) - Add more rebase notes for Fedora 5.16 (Justin M. Forbes) - Fedora: Feature: Retire wireless Extensions (Peter Robinson) - fedora: arm: some SoC enablement pieces (Peter Robinson) - fedora: arm: enable PCIE_ROCKCHIP_DW for rk35xx series (Peter Robinson) - fedora: enable RTW89 802.11 WiFi driver (Peter Robinson) - fedora: arm: Enable DRM_PANEL_EDP (Peter Robinson) - fedora: sound: enable new sound drivers (Peter Robinson) - redhat/configs: unset KEXEC_SIG for s390x zfcpdump (Coiby Xu) - spec: Keep .BTF section in modules (Jiri Olsa) - Fix up PREEMPT configs (Justin M. Forbes) - New configs in drivers/media (Fedora Kernel Team) - New configs in drivers/net/ethernet/litex (Fedora Kernel Team) - spec: add bpf_testmod.ko to kselftests/bpf (Viktor Malik) - New configs in drivers/net/wwan (Fedora Kernel Team) - New configs in drivers/i2c (Fedora Kernel Team) - redhat/docs/index.rst: Add local build information. (Prarit Bhargava) - Fix up preempt configs (Justin M. Forbes) - Turn on CONFIG_HID_NINTENDO for controller support (Dave Olsthoorn) - Fedora: Enable MediaTek bluetooth pieces (Peter Robinson) - Add rebase notes to check for PCI patches (Justin M. Forbes) - redhat: configs: move CONFIG_ACCESSIBILITY from fedora to common (John W. Linville) - Filter updates for hid-playstation on Fedora (Justin M. Forbes) - Enable CONFIG_VIRT_DRIVERS for ARK (Vitaly Kuznetsov) - redhat/configs: Enable Nitro Enclaves on aarch64 (Vitaly Kuznetsov) - Enable e1000 in rhel9 as unsupported (Ken Cox) [2002344] - Turn on COMMON_CLK_AXG_AUDIO for Fedora rhbz 2020481 (Justin M. Forbes) - Fix up fedora config options from mismatch (Justin M. Forbes) - Add nct6775 to filter-modules.sh.rhel (Justin M. Forbes) - Enable PREEMPT_DYNAMIC for all but s390x (Justin M. Forbes) - Add memcpy_kunit to mod-internal.list (Justin M. Forbes) - New configs in fs/ksmbd (Fedora Kernel Team) - Add nct6775 to Fedora filter-modules.sh (Justin M. Forbes) - New configs in fs/ntfs3 (Fedora Kernel Team) - Make CONFIG_IOMMU_DEFAULT_DMA_STRICT default for all but x86 (Justin M. Forbes) - redhat/configs: enable KEXEC_IMAGE_VERIFY_SIG for RHEL (Coiby Xu) - redhat/configs: enable KEXEC_SIG for aarch64 RHEL (Coiby Xu) [1994858] - Fix up fedora and pending configs for PREEMPT to end mismatch (Justin M. Forbes) - Enable binder for fedora (Justin M. Forbes) - redhat: configs: Update configs for vmware (Kamal Heib) - Fedora configs for 5.15 (Justin M. Forbes) - redhat/kernel.spec.template: don't hardcode gcov arches (Jan Stancek) - redhat/configs: create a separate config for gcov options (Jan Stancek) - Update documentation with FAQ and update frequency (Don Zickus) - Document force pull option for mirroring (Don Zickus) - Ignore the rhel9 kabi files (Don Zickus) - Remove legacy elrdy cruft (Don Zickus) - redhat/configs/evaluate_configs: walk cfgvariants line by line (Jan Stancek) - redhat/configs/evaluate_configs: insert EMPTY tags at correct place (Jan Stancek) - redhat: make dist-srpm-gcov add to BUILDOPTS (Jan Stancek) - Build CONFIG_SPI_PXA2XX as a module on x86 (Justin M. Forbes) - redhat/configs: enable CONFIG_BCMGENET as module (Joel Savitz) - Fedora config updates (Justin M. Forbes) - Enable CONFIG_FAIL_SUNRPC for debug builds (Justin M. Forbes) - fedora: Disable fbdev drivers and use simpledrm instead (Javier Martinez Canillas) - spec: Don't fail spec build if ksamples fails (Jiri Olsa) - Enable CONFIG_QCOM_SCM for arm (Justin M. Forbes) - redhat: Disable clang's integrated assembler on ppc64le and s390x (Tom Stellard) - redhat/configs: enable CONFIG_IMA_WRITE_POLICY (Bruno Meneguele) - Fix dist-srpm-gcov (Don Zickus) - redhat: configs: add CONFIG_NTB and related items (John W. Linville) - Add kfence_test to mod-internal.list (Justin M. Forbes) - Enable KUNIT tests for redhat kernel-modules-internal (Nico Pache) - redhat: add *-matched meta packages to rpminspect emptyrpm config (Herton R. Krzesinski) - Use common config for NODES_SHIFT (Mark Salter) - redhat: fix typo and make the output more silent for dist-git sync (Herton R. Krzesinski) - Fedora NTFS config updates (Justin M. Forbes) - Fedora 5.15 configs part 1 (Justin M. Forbes) - Fix ordering in genspec args (Justin M. Forbes) - redhat/configs: Enable Hyper-V guests on ARM64 (Vitaly Kuznetsov) [2007430] - redhat: configs: Enable CONFIG_THINKPAD_LMI (Hans de Goede) - redhat/docs: update Koji link to avoid redirect (Joel Savitz) - redhat: add support for different profiles with dist*-brew (Herton R. Krzesinski) - redhat: configs: Disable xtables and ipset (Phil Sutter) [1945179] - redhat: Add mark_driver_deprecated() (Phil Sutter) [1945179] - Change s390x CONFIG_NODES_SHIFT from 4 to 1 (Justin M. Forbes) - Build CRYPTO_SHA3_*_S390 inline for s390 zfcpdump (Justin M. Forbes) - redhat: move the DIST variable setting to Makefile.variables (Herton R. Krzesinski) - redhat/kernel.spec.template: Cleanup source numbering (Prarit Bhargava) - redhat/kernel.spec.template: Reorganize RHEL and Fedora specific files (Prarit Bhargava) - redhat/kernel.spec.template: Add include_fedora and include_rhel variables (Prarit Bhargava) - redhat/Makefile: Make kernel-local global (Prarit Bhargava) - redhat/Makefile: Use flavors file (Prarit Bhargava) - Turn on CONFIG_CPU_FREQ_GOV_SCHEDUTIL for x86 (Justin M. Forbes) - redhat/configs: Remove CONFIG_INFINIBAND_I40IW (Kamal Heib) - cleanup CONFIG_X86_PLATFORM_DRIVERS_INTEL (David Arcari) - redhat: rename usage of .rhel8git.mk to .rhpkg.mk (Herton R. Krzesinski) - Manually add pending items that need to be set due to mismatch (Justin M. Forbes) - Clean up pending common (Justin M. Forbes) - redhat/configs: Enable CONFIG_BLK_CGROUP_IOLATENCY & CONFIG_BLK_CGROUP_FC_APPID (Waiman Long) [2006813] - redhat: remove kernel.changelog-8.99 file (Herton R. Krzesinski) - redhat/configs: enable CONFIG_SQUASHFS_ZSTD which is already enabled in Fedora 34 (Tao Liu) [1998953] - redhat: bump RHEL_MAJOR and add the changelog file for it (Herton R. Krzesinski) - redhat: add documentation about the os-build rebase process (Herton R. Krzesinski) - redhat/configs: enable SYSTEM_BLACKLIST_KEYRING which is already enabled in rhel8 and Fedora 34 (Coiby Xu) - Build kernel-doc for Fedora (Justin M. Forbes) - x86_64: Enable Elkhart Lake Quadrature Encoder Peripheral support (Prarit Bhargava) - Update CONFIG_WERROR to disabled as it can cause issue with out of tree modules. (Justin M. Forbes) - Fixup IOMMU configs in pending so that configs are sane again (Justin M. Forbes) - Some initial Fedora config items for 5.15 (Justin M. Forbes) - arm64: use common CONFIG_MAX_ZONEORDER for arm kernel (Mark Salter) - Create Makefile.variables for a single point of configuration change (Justin M. Forbes) - rpmspec: drop traceevent files instead of just excluding them from files list (Herton R. Krzesinski) [1967640] - redhat/config: Enablement of CONFIG_PAPR_SCM for PowerPC (Gustavo Walbon) [1962936] - Attempt to fix Intel PMT code (David Arcari) - CI: Enable realtime branch testing (Veronika Kabatova) - CI: Enable realtime checks for c9s and RHEL9 (Veronika Kabatova) - ark: wireless: enable all rtw88 pcie wirless variants (Peter Robinson) - wireless: rtw88: move debug options to common/debug (Peter Robinson) - fedora: minor PTP clock driver cleanups (Peter Robinson) - common: x86: enable VMware PTP support on ark (Peter Robinson) - [scsi] megaraid_sas: re-add certain pci-ids (Tomas Henzl) - Disable liquidio driver on ark/rhel (Herton R. Krzesinski) [1993393] - More Fedora config updates (Justin M. Forbes) - Fedora config updates for 5.14 (Justin M. Forbes) - CI: Rename ARK CI pipeline type (Veronika Kabatova) - CI: Finish up c9s config (Veronika Kabatova) - CI: Update ppc64le config (Veronika Kabatova) - CI: use more templates (Veronika Kabatova) - Filter updates for aarch64 (Justin M. Forbes) - increase CONFIG_NODES_SHIFT for aarch64 (Chris von Recklinghausen) [1890304] - redhat: configs: Enable CONFIG_WIRELESS_HOTKEY (Hans de Goede) - redhat/configs: Update CONFIG_NVRAM (Desnes A. Nunes do Rosario) [1988254] - common: serial: build in SERIAL_8250_LPSS for x86 (Peter Robinson) - powerpc: enable CONFIG_FUNCTION_PROFILER (Diego Domingos) [1831065] - redhat/configs: Disable Soft-RoCE driver (Kamal Heib) - redhat/configs/evaluate_configs: Update help output (Prarit Bhargava) - redhat/configs: Double MAX_LOCKDEP_CHAINS (Justin M. Forbes) - fedora: configs: Fix WM5102 Kconfig (Hans de Goede) - powerpc: enable CONFIG_POWER9_CPU (Diego Domingos) [1876436] - redhat/configs: Fix CONFIG_VIRTIO_IOMMU to 'y' on aarch64 (Eric Auger) [1972795] - filter-modules.sh: add more sound modules to filter (Jaroslav Kysela) - redhat/configs: sound configuration cleanups and updates (Jaroslav Kysela) - common: Update for CXL (Compute Express Link) configs (Peter Robinson) - redhat: configs: disable CRYPTO_SM modules (Herton R. Krzesinski) [1990040] - Remove fedora version of the LOCKDEP_BITS, we should use common (Justin M. Forbes) - Re-enable sermouse for x86 (rhbz 1974002) (Justin M. Forbes) - Fedora 5.14 configs round 1 (Justin M. Forbes) - redhat: add gating configuration for centos stream/rhel9 (Herton R. Krzesinski) - x86: configs: Enable CONFIG_TEST_FPU for debug kernels (Vitaly Kuznetsov) [1988384] - redhat/configs: Move CHACHA and POLY1305 to core kernel to allow BIG_KEYS=y (root) [1983298] - kernel.spec: fix build of samples/bpf (Jiri Benc) - Enable OSNOISE_TRACER and TIMERLAT_TRACER (Jerome Marchand) [1979379] - rpmspec: switch iio and gpio tools to use tools_make (Herton R. Krzesinski) [1956988] - configs/process_configs.sh: Handle config items with no help text (Patrick Talbert) - fedora: sound config updates for 5.14 (Peter Robinson) - fedora: Only enable FSI drivers on POWER platform (Peter Robinson) - The CONFIG_RAW_DRIVER has been removed from upstream (Peter Robinson) - fedora: updates for 5.14 with a few disables for common from pending (Peter Robinson) - fedora: migrate from MFD_TPS68470 -> INTEL_SKL_INT3472 (Peter Robinson) - fedora: Remove STAGING_GASKET_FRAMEWORK (Peter Robinson) - Fedora: move DRM_VMWGFX configs from ark -> common (Peter Robinson) - fedora: arm: disabled unused FB drivers (Peter Robinson) - fedora: don't enable FB_VIRTUAL (Peter Robinson) - redhat/configs: Double MAX_LOCKDEP_ENTRIES (Waiman Long) [1940075] - rpmspec: fix verbose output on kernel-devel installation (Herton R. Krzesinski) [1981406] - Build Fedora x86s kernels with bytcr-wm5102 (Marius Hoch) - Deleted redhat/configs/fedora/generic/x86/CONFIG_FB_HYPERV (Patrick Lang) - rpmspec: correct the ghost initramfs attributes (Herton R. Krzesinski) [1977056] - rpmspec: amend removal of depmod created files to include modules.builtin.alias.bin (Herton R. Krzesinski) [1977056] - configs: remove duplicate CONFIG_DRM_HYPERV file (Patrick Talbert) - CI: use common code for merge and release (Don Zickus) - rpmspec: add release string to kernel doc directory name (Jan Stancek) - redhat/configs: Add CONFIG_INTEL_PMT_CRASHLOG (Michael Petlan) [1880486] - redhat/configs: Add CONFIG_INTEL_PMT_TELEMETRY (Michael Petlan) [1880486] - redhat/configs: Add CONFIG_MFD_INTEL_PMT (Michael Petlan) [1880486] - redhat/configs: enable CONFIG_BLK_DEV_ZONED (Ming Lei) [1638087] - Add --with clang_lto option to build the kernel with Link Time Optimizations (Tom Stellard) - common: disable DVB_AV7110 and associated pieces (Peter Robinson) - Fix fedora-only config updates (Don Zickus) - Fedor config update for new option (Justin M. Forbes) - redhat/configs: Enable stmmac NIC for x86_64 (Mark Salter) - all: hyperv: use the DRM driver rather than FB (Peter Robinson) - all: hyperv: unify the Microsoft HyperV configs (Peter Robinson) - all: VMWare: clean up VMWare configs (Peter Robinson) - Update CONFIG_ARM_FFA_TRANSPORT (Patrick Talbert) - CI: Handle all mirrors (Veronika Kabatova) - Turn on CONFIG_STACKTRACE for s390x zfpcdump kernels (Justin M. Forbes) - arm64: switch ark kernel to 4K pagesize (Mark Salter) - Disable AMIGA_PARTITION and KARMA_PARTITION (Prarit Bhargava) [1802694] - all: unify and cleanup i2c TPM2 modules (Peter Robinson) - redhat/configs: Set CONFIG_VIRTIO_IOMMU on aarch64 (Eric Auger) [1972795] - redhat/configs: Disable CONFIG_RT_GROUP_SCHED in rhel config (Phil Auld) - redhat/configs: enable KEXEC_SIG which is already enabled in RHEL8 for s390x and x86_64 (Coiby Xu) [1976835] - rpmspec: do not BuildRequires bpftool on noarch (Herton R. Krzesinski) - redhat/configs: disable {IMA,EVM}_LOAD_X509 (Bruno Meneguele) [1977529] - redhat: add secureboot CA certificate to trusted kernel keyring (Bruno Meneguele) - redhat/configs: enable IMA_ARCH_POLICY for aarch64 and s390x (Bruno Meneguele) - redhat/configs: Enable CONFIG_MLXBF_GIGE on aarch64 (Alaa Hleihel) [1858599] - common: enable STRICT_MODULE_RWX everywhere (Peter Robinson) - COMMON_CLK_STM32MP157_SCMI is bool and selects COMMON_CLK_SCMI (Justin M. Forbes) - kernel.spec: Add kernel{,-debug}-devel-matched meta packages (Timothée Ravier) - Turn off with_selftests for Fedora (Justin M. Forbes) - Don't build bpftool on Fedora (Justin M. Forbes) - Fix location of syscall scripts for kernel-devel (Justin M. Forbes) - fedora: arm: Enable some i.MX8 options (Peter Robinson) - Enable Landlock for Fedora (Justin M. Forbes) - Filter update for Fedora aarch64 (Justin M. Forbes) - rpmspec: only build debug meta packages where we build debug ones (Herton R. Krzesinski) - rpmspec: do not BuildRequires bpftool on nobuildarches (Herton R. Krzesinski) - redhat/configs: Consolidate CONFIG_HMC_DRV in the common s390x folder (Thomas Huth) [1976270] - redhat/configs: Consolidate CONFIG_EXPOLINE_OFF in the common folder (Thomas Huth) [1976270] - redhat/configs: Move CONFIG_HW_RANDOM_S390 into the s390x/ subfolder (Thomas Huth) [1976270] - redhat/configs: Disable CONFIG_HOTPLUG_PCI_SHPC in the Fedora settings (Thomas Huth) [1976270] - redhat/configs: Remove the non-existent CONFIG_NO_BOOTMEM switch (Thomas Huth) [1976270] - redhat/configs: Compile the virtio-console as a module on s390x (Thomas Huth) [1976270] - redhat/configs: Enable CONFIG_S390_CCW_IOMMU and CONFIG_VFIO_CCW for ARK, too (Thomas Huth) [1976270] - Revert "Merge branch 'ec_fips' into 'os-build'" (Vladis Dronov) [1947240] - Fix typos in fedora filters (Justin M. Forbes) - More filtering for Fedora (Justin M. Forbes) - Fix Fedora module filtering for spi-altera-dfl (Justin M. Forbes) - Fedora 5.13 config updates (Justin M. Forbes) - fedora: cleanup TCG_TIS_I2C_CR50 (Peter Robinson) - fedora: drop duplicate configs (Peter Robinson) - More Fedora config updates for 5.13 (Justin M. Forbes) - redhat/configs: Enable needed drivers for BlueField SoC on aarch64 (Alaa Hleihel) [1858592 1858594 1858596] - redhat: Rename mod-blacklist.sh to mod-denylist.sh (Prarit Bhargava) - redhat/configs: enable CONFIG_NET_ACT_MPLS (Marcelo Ricardo Leitner) - configs: Enable CONFIG_DEBUG_KERNEL for zfcpdump (Jiri Olsa) - kernel.spec: Add support to use vmlinux.h (Don Zickus) - spec: Add vmlinux.h to kernel-devel package (Jiri Olsa) - Turn off DRM_XEN_FRONTEND for Fedora as we had DRM_XEN off already (Justin M. Forbes) - Fedora 5.13 config updates pt 3 (Justin M. Forbes) - all: enable ath11k wireless modules (Peter Robinson) - all: Enable WWAN and associated MHI bus pieces (Peter Robinson) - spec: Enable sefltests rpm build (Jiri Olsa) - spec: Allow bpf selftest/samples to fail (Jiri Olsa) - kvm: Add kvm_stat.service file and kvm_stat logrotate config to the tools (Jiri Benc) - kernel.spec: Add missing source files to kernel-selftests-internal (Jiri Benc) - kernel.spec: selftests: add net/forwarding to TARGETS list (Jiri Benc) - kernel.spec: selftests: add build requirement on libmnl-devel (Jiri Benc) - kernel.spec: add action.o to kernel-selftests-internal (Jiri Benc) - kernel.spec: avoid building bpftool repeatedly (Jiri Benc) - kernel.spec: selftests require python3 (Jiri Benc) - kernel.spec: skip selftests that failed to build (Jiri Benc) - kernel.spec: fix installation of bpf selftests (Jiri Benc) - redhat: fix samples and selftests make options (Jiri Benc) - kernel.spec: enable mptcp selftests for kernel-selftests-internal (Jiri Benc) - kernel.spec: Do not export shared objects from libexecdir to RPM Provides (Jiri Benc) - kernel.spec: add missing dependency for the which package (Jiri Benc) - kernel.spec: add netfilter selftests to kernel-selftests-internal (Jiri Benc) - kernel.spec: move slabinfo and page_owner_sort debuginfo to tools-debuginfo (Jiri Benc) - kernel.spec: package and ship VM tools (Jiri Benc) - configs: enable CONFIG_PAGE_OWNER (Jiri Benc) - kernel.spec: add coreutils (Jiri Benc) - kernel.spec: add netdevsim driver selftests to kernel-selftests-internal (Jiri Benc) - redhat/Makefile: Clean out the --without flags from the baseonly rule (Jiri Benc) - kernel.spec: Stop building unnecessary rpms for baseonly builds (Jiri Benc) - kernel.spec: disable more kabi switches for gcov build (Jiri Benc) - kernel.spec: Rename kabi-dw base (Jiri Benc) - kernel.spec: Fix error messages during build of zfcpdump kernel (Jiri Benc) - kernel.spec: perf: remove bpf examples (Jiri Benc) - kernel.spec: selftests should not depend on modules-internal (Jiri Benc) - kernel.spec: build samples (Jiri Benc) - kernel.spec: tools: sync missing options with RHEL 8 (Jiri Benc) - redhat/configs: nftables: Enable extra flowtable symbols (Phil Sutter) - redhat/configs: Sync netfilter options with RHEL8 (Phil Sutter) - Fedora 5.13 config updates pt 2 (Justin M. Forbes) - Move CONFIG_ARCH_INTEL_SOCFPGA up a level for Fedora (Justin M. Forbes) - fedora: enable the Rockchip rk3399 pcie drivers (Peter Robinson) - Fedora 5.13 config updates pt 1 (Justin M. Forbes) - Fix version requirement from opencsd-devel buildreq (Justin M. Forbes) - configs/ark/s390: set CONFIG_MARCH_Z14 and CONFIG_TUNE_Z15 (Philipp Rudo) [1876435] - configs/common/s390: Clean up CONFIG_{MARCH,TUNE}_Z* (Philipp Rudo) - configs/process_configs.sh: make use of dummy-tools (Philipp Rudo) - configs/common: disable CONFIG_INIT_STACK_ALL_{PATTERN,ZERO} (Philipp Rudo) - configs/common/aarch64: disable CONFIG_RELR (Philipp Rudo) - redhat/config: enable STMICRO nic for RHEL (Mark Salter) - redhat/configs: Enable ARCH_TEGRA on RHEL (Mark Salter) - redhat/configs: enable IMA_KEXEC for supported arches (Bruno Meneguele) - redhat/configs: enable INTEGRITY_SIGNATURE to all arches (Bruno Meneguele) - configs: enable CONFIG_LEDS_BRIGHTNESS_HW_CHANGED (Benjamin Tissoires) - RHEL: disable io_uring support (Jeff Moyer) [1964537] - all: Changing CONFIG_UV_SYSFS to build uv_sysfs.ko as a loadable module. (Frank Ramsay) - Enable NITRO_ENCLAVES on RHEL (Vitaly Kuznetsov) - Update the Quick Start documentation (David Ward) - redhat/configs: Set PVPANIC_MMIO for x86 and PVPANIC_PCI for aarch64 (Eric Auger) [1961178] - bpf: Fix unprivileged_bpf_disabled setup (Jiri Olsa) - Enable CONFIG_BPF_UNPRIV_DEFAULT_OFF (Jiri Olsa) - configs/common/s390: disable CONFIG_QETH_{OSN,OSX} (Philipp Rudo) [1903201] - nvme: nvme_mpath_init remove multipath check (Mike Snitzer) - Make CRYPTO_EC also builtin (Simo Sorce) [1947240] - Do not hard-code a default value for DIST (David Ward) - Override %{debugbuildsenabled} if the --with-release option is used (David Ward) - Improve comments in SPEC file, and move some option tests and macros (David Ward) - configs: enable CONFIG_EXFAT_FS (Pavel Reichl) [1943423] - Revert s390x/zfcpdump part of a9d179c40281 and ecbfddd98621 (Vladis Dronov) - Embed crypto algos, modes and templates needed in the FIPS mode (Vladis Dronov) [1947240] - configs: Add and enable CONFIG_HYPERV_TESTING for debug kernels (Mohammed Gamal) - configs: enable CONFIG_CMA on x86_64 in ARK (David Hildenbrand) [1945002] - rpmspec: build debug-* meta-packages if debug builds are disabled (Herton R. Krzesinski) - UIO: disable unused config options (Aristeu Rozanski) [1957819] - ARK-config: Make amd_pinctrl module builtin (Hans de Goede) - rpmspec: revert/drop content hash for kernel-headers (Herton R. Krzesinski) - rpmspec: fix check that calls InitBuildVars (Herton R. Krzesinski) - fedora: enable zonefs (Damien Le Moal) - redhat: load specific ARCH keys to INTEGRITY_PLATFORM_KEYRING (Bruno Meneguele) - redhat: enable INTEGRITY_TRUSTED_KEYRING across all variants (Bruno Meneguele) - redhat: enable SYSTEM_BLACKLIST_KEYRING across all variants (Bruno Meneguele) - redhat: enable INTEGRITY_ASYMMETRIC_KEYS across all variants (Bruno Meneguele) - Remove unused boot loader specification files (David Ward) - redhat/configs: Enable mlx5 IPsec and TLS offloads (Alaa Hleihel) [1869674 1957636] - common: disable Apple Silicon generally (Peter Robinson) - cleanup Intel's FPGA configs (Peter Robinson) - common: move PTP KVM support from ark to common (Peter Robinson) - Enable CONFIG_DRM_AMDGPU_USERPTR for everyone (Justin M. Forbes) - redhat: add initial rpminspect configuration (Herton R. Krzesinski) - fedora: arm updates for 5.13 (Peter Robinson) - fedora: Enable WWAN and associated MHI bits (Peter Robinson) - Update CONFIG_MODPROBE_PATH to /usr/sbin (Justin Forbes) - Fedora set modprobe path (Justin M. Forbes) - Keep sctp and l2tp modules in modules-extra (Don Zickus) - Fix ppc64le cross build packaging (Don Zickus) - Fedora: Make amd_pinctrl module builtin (Hans de Goede) - Keep CONFIG_KASAN_HW_TAGS off for aarch64 debug configs (Justin M. Forbes) - New configs in drivers/bus (Fedora Kernel Team) - RHEL: Don't build KVM PR module on ppc64 (David Gibson) [1930649] - Flip CONFIG_USB_ROLE_SWITCH from m to y (Justin M. Forbes) - Set valid options for CONFIG_FW_LOADER_USER_HELPER (Justin M. Forbes) - Clean up CONFIG_FB_MODE_HELPERS (Justin M. Forbes) - Turn off CONFIG_VFIO for the s390x zfcpdump kernel (Justin M. Forbes) - Delete unused CONFIG_SND_SOC_MAX98390 pending-common (Justin M. Forbes) - Update pending-common configs, preparing to set correctly (Justin M. Forbes) - Update fedora filters for surface (Justin M. Forbes) - Build CONFIG_CRYPTO_ECDSA inline for s390x zfcpdump (Justin M. Forbes) - Replace "flavour" where "variant" is meant instead (David Ward) - Drop the %{variant} macro and fix --with-vanilla (David Ward) - Fix syntax of %kernel_variant_files (David Ward) - Change description of --without-vdso-install to fix typo (David Ward) - Config updates to work around mismatches (Justin M. Forbes) - CONFIG_SND_SOC_FSL_ASOC_CARD selects CONFIG_MFD_WM8994 now (Justin M. Forbes) - wireguard: disable in FIPS mode (Hangbin Liu) [1940794] - Enable mtdram for fedora (rhbz 1955916) (Justin M. Forbes) - Remove reference to bpf-helpers man page (Justin M. Forbes) - Fedora: enable more modules for surface devices (Dave Olsthoorn) - Fix Fedora config mismatch for CONFIG_FSL_ENETC_IERB (Justin M. Forbes) - hardlink is in /usr/bin/ now (Justin M. Forbes) - Ensure CONFIG_KVM_BOOK3S_64_PR stays on in Fedora, even if it is turned off in RHEL (Justin M. Forbes) - Set date in package release from repository commit, not system clock (David Ward) - Use a better upstream tarball filename for snapshots (David Ward) - Don't create empty pending-common files on pending-fedora commits (Don Zickus) - nvme: decouple basic ANA log page re-read support from native multipathing (Mike Snitzer) - nvme: allow local retry and proper failover for REQ_FAILFAST_TRANSPORT (Mike Snitzer) - nvme: Return BLK_STS_TARGET if the DNR bit is set (Mike Snitzer) - Add redhat/configs/pending-common/generic/s390x/zfcpdump/CONFIG_NETFS_SUPPORT (Justin M. Forbes) - Create ark-latest branch last for CI scripts (Don Zickus) - Replace /usr/libexec/platform-python with /usr/bin/python3 (David Ward) - Turn off ADI_AXI_ADC and AD9467 which now require CONFIG_OF (Justin M. Forbes) - Export ark infrastructure files (Don Zickus) - docs: Update docs to reflect newer workflow. (Don Zickus) - Use upstream/master for merge-base with fallback to master (Don Zickus) - Fedora: Turn off the SND_INTEL_BYT_PREFER_SOF option (Hans de Goede) - filter-modules.sh.fedora: clean up "netprots" (Paul Bolle) - filter-modules.sh.fedora: clean up "scsidrvs" (Paul Bolle) - filter-*.sh.fedora: clean up "ethdrvs" (Paul Bolle) - filter-*.sh.fedora: clean up "driverdirs" (Paul Bolle) - filter-*.sh.fedora: remove incorrect entries (Paul Bolle) - filter-*.sh.fedora: clean up "singlemods" (Paul Bolle) - filter-modules.sh.fedora: drop unused list "iiodrvs" (Paul Bolle) - Update mod-internal to fix depmod issue (Nico Pache) - Turn on CONFIG_VDPA_SIM_NET (rhbz 1942343) (Justin M. Forbes) - New configs in drivers/power (Fedora Kernel Team) - Turn on CONFIG_NOUVEAU_DEBUG_PUSH for debug configs (Justin M. Forbes) - Turn off KFENCE sampling by default for Fedora (Justin M. Forbes) - Fedora config updates round 2 (Justin M. Forbes) - New configs in drivers/soc (Jeremy Cline) - filter-modules.sh: Fix copy/paste error 'input' (Paul Bolle) - Update module filtering for 5.12 kernels (Justin M. Forbes) - Fix genlog.py to ensure that comments retain "%" characters. (Mark Mielke) - New configs in drivers/leds (Fedora Kernel Team) - Limit CONFIG_USB_CDNS_SUPPORT to x86_64 and arm in Fedora (David Ward) - Fedora: Enable CHARGER_GPIO on aarch64 too (Peter Robinson) - Fedora config updates (Justin M. Forbes) - configs: enable CONFIG_WIREGUARD in ARK (Hangbin Liu) [1613522] - Remove duplicate configs acroos fedora, ark and common (Don Zickus) - Combine duplicate configs across ark and fedora into common (Don Zickus) - common/ark: cleanup and unify the parport configs (Peter Robinson) - iommu/vt-d: enable INTEL_IDXD_SVM for both fedora and rhel (Jerry Snitselaar) - REDHAT: coresight: etm4x: Disable coresight on HPE Apollo 70 (Jeremy Linton) - configs/common/generic: disable CONFIG_SLAB_MERGE_DEFAULT (Rafael Aquini) - Remove _legacy_common_support (Justin M. Forbes) - redhat/mod-blacklist.sh: Fix floppy blacklisting (Hans de Goede) - New configs in fs/pstore (CKI@GitLab) - New configs in arch/powerpc (Fedora Kernel Team) - configs: enable BPF LSM on Fedora and ARK (Ondrej Mosnacek) - configs: clean up LSM configs (Ondrej Mosnacek) - New configs in drivers/platform (CKI@GitLab) - New configs in drivers/firmware (CKI@GitLab) - New configs in drivers/mailbox (Fedora Kernel Team) - New configs in drivers/net/phy (Justin M. Forbes) - Update CONFIG_DM_MULTIPATH_IOA (Augusto Caringi) - New configs in mm/Kconfig (CKI@GitLab) - New configs in arch/powerpc (Jeremy Cline) - New configs in arch/powerpc (Jeremy Cline) - New configs in drivers/input (Fedora Kernel Team) - New configs in net/bluetooth (Justin M. Forbes) - New configs in drivers/clk (Fedora Kernel Team) - New configs in init/Kconfig (Jeremy Cline) - redhat: allow running fedora-configs and rh-configs targets outside of redhat/ (Herton R. Krzesinski) - all: unify the disable of goldfish (android emulation platform) (Peter Robinson) - common: minor cleanup/de-dupe of dma/dmabuf debug configs (Peter Robinson) - common/ark: these drivers/arches were removed in 5.12 (Peter Robinson) - Correct kernel-devel make prepare build for 5.12. (Paulo E. Castro) - redhat: add initial support for centos stream dist-git sync on Makefiles (Herton R. Krzesinski) - redhat/configs: Enable CONFIG_SCHED_STACK_END_CHECK for Fedora and ARK (Josh Poimboeuf) [1856174] - CONFIG_VFIO now selects IOMMU_API instead of depending on it, causing several config mismatches for the zfcpdump kernel (Justin M. Forbes) - Turn off weak-modules for Fedora (Justin M. Forbes) - redhat: enable CONFIG_FW_LOADER_COMPRESS for ARK (Herton R. Krzesinski) [1939095] - Fedora: filters: update to move dfl-emif to modules (Peter Robinson) - drop duplicate DEVFREQ_GOV_SIMPLE_ONDEMAND config (Peter Robinson) - efi: The EFI_VARS is legacy and now x86 only (Peter Robinson) - common: enable RTC_SYSTOHC to supplement update_persistent_clock64 (Peter Robinson) - generic: arm: enable SCMI for all options (Peter Robinson) - fedora: the PCH_CAN driver is x86-32 only (Peter Robinson) - common: disable legacy CAN device support (Peter Robinson) - common: Enable Microchip MCP251x/MCP251xFD CAN controllers (Peter Robinson) - common: Bosch MCAN support for Intel Elkhart Lake (Peter Robinson) - common: enable CAN_PEAK_PCIEFD PCI-E driver (Peter Robinson) - common: disable CAN_PEAK_PCIEC PCAN-ExpressCard (Peter Robinson) - common: enable common CAN layer 2 protocols (Peter Robinson) - ark: disable CAN_LEDS option (Peter Robinson) - Fedora: Turn on SND_SOC_INTEL_SKYLAKE_HDAUDIO_CODEC option (Hans de Goede) - Fedora: enable modules for surface devices (Dave Olsthoorn) - Turn on SND_SOC_INTEL_SOUNDWIRE_SOF_MACH for Fedora again (Justin M. Forbes) - common: fix WM8804 codec dependencies (Peter Robinson) - Build SERIO_SERPORT as a module (Peter Robinson) - input: touchscreen: move ELO and Wacom serial touchscreens to x86 (Peter Robinson) - Sync serio touchscreens for non x86 architectures to the same as ARK (Peter Robinson) - Only enable SERIO_LIBPS2 on x86 (Peter Robinson) - Only enable PC keyboard controller and associated keyboard on x86 (Peter Robinson) - Generic: Mouse: Tweak generic serial mouse options (Peter Robinson) - Only enable PS2 Mouse options on x86 (Peter Robinson) - Disable bluetooth highspeed by default (Peter Robinson) - Fedora: A few more general updates for 5.12 window (Peter Robinson) - Fedora: Updates for 5.12 merge window (Peter Robinson) - Fedora: remove dead options that were removed upstream (Peter Robinson) - redhat: remove CONFIG_DRM_PANEL_XINGBANGDA_XBD599 (Herton R. Krzesinski) - New configs in arch/powerpc (Fedora Kernel Team) - Turn on CONFIG_PPC_QUEUED_SPINLOCKS as it is default upstream now (Justin M. Forbes) - Update pending-common configs to address new upstream config deps (Justin M. Forbes) - rpmspec: ship gpio-watch.debug in the proper debuginfo package (Herton R. Krzesinski) - Removed description text as a comment confuses the config generation (Justin M. Forbes) - New configs in drivers/dma-buf (Jeremy Cline) - Fedora: ARMv7: build for 16 CPUs. (Peter Robinson) - Fedora: only enable DEBUG_HIGHMEM on debug kernels (Peter Robinson) - process_configs.sh: fix find/xargs data flow (Ondrej Mosnacek) - Fedora config update (Justin M. Forbes) - fedora: minor arm sound config updates (Peter Robinson) - Fix trailing white space in redhat/configs/fedora/generic/CONFIG_SND_INTEL_BYT_PREFER_SOF (Justin M. Forbes) - Add a redhat/rebase-notes.txt file (Hans de Goede) - Turn on SND_INTEL_BYT_PREFER_SOF for Fedora (Hans de Goede) - CI: Drop MR ID from the name variable (Veronika Kabatova) - redhat: add DUP and kpatch certificates to system trusted keys for RHEL build (Herton R. Krzesinski) - The comments in CONFIG_USB_RTL8153_ECM actually turn off CONFIG_USB_RTL8152 (Justin M. Forbes) - Update CKI pipeline project (Veronika Kabatova) - Turn off additional KASAN options for Fedora (Justin M. Forbes) - Rename the master branch to rawhide for Fedora (Justin M. Forbes) - Makefile targets for packit integration (Ben Crocker) - Turn off KASAN for rawhide debug builds (Justin M. Forbes) - New configs in arch/arm64 (Justin Forbes) - Remove deprecated Intel MIC config options (Peter Robinson) - redhat: replace inline awk script with genlog.py call (Herton R. Krzesinski) - redhat: add genlog.py script (Herton R. Krzesinski) - kernel.spec.template - fix use_vdso usage (Ben Crocker) - redhat: remove remaining references of CONFIG_RH_DISABLE_DEPRECATED (Herton R. Krzesinski) - Turn off vdso_install for ppc (Justin M. Forbes) - Remove bpf-helpers.7 from bpftool package (Jiri Olsa) - New configs in lib/Kconfig.debug (Fedora Kernel Team) - Turn off CONFIG_VIRTIO_CONSOLE for s390x zfcpdump (Justin M. Forbes) - New configs in drivers/clk (Justin M. Forbes) - Keep VIRTIO_CONSOLE on s390x available. (Jakub Čajka) - New configs in lib/Kconfig.debug (Jeremy Cline) - Fedora 5.11 config updates part 4 (Justin M. Forbes) - Fedora 5.11 config updates part 3 (Justin M. Forbes) - Fedora 5.11 config updates part 2 (Justin M. Forbes) - Update internal (test) module list from RHEL-8 (Joe Lawrence) [1915073] - Fix USB_XHCI_PCI regression (Justin M. Forbes) - fedora: fixes for ARMv7 build issue by disabling HIGHPTE (Peter Robinson) - all: s390x: Increase CONFIG_PCI_NR_FUNCTIONS to 512 (#1888735) (Dan Horák) - Fedora 5.11 configs pt 1 (Justin M. Forbes) - redhat: avoid conflict with mod-blacklist.sh and released_kernel defined (Herton R. Krzesinski) - redhat: handle certificate files conditionally as done for src.rpm (Herton R. Krzesinski) - specfile: add %{?_smp_mflags} to "make headers_install" in tools/testing/selftests (Denys Vlasenko) - specfile: add %{?_smp_mflags} to "make samples/bpf/" (Denys Vlasenko) - Run MR testing in CKI pipeline (Veronika Kabatova) - Reword comment (Nicolas Chauvet) - Add with_cross_arm conditional (Nicolas Chauvet) - Redefines __strip if with_cross (Nicolas Chauvet) - fedora: only enable ACPI_CONFIGFS, ACPI_CUSTOM_METHOD in debug kernels (Peter Robinson) - fedora: User the same EFI_CUSTOM_SSDT_OVERLAYS as ARK (Peter Robinson) - all: all arches/kernels enable the same DMI options (Peter Robinson) - all: move SENSORS_ACPI_POWER to common/generic (Peter Robinson) - fedora: PCIE_HISI_ERR is already in common (Peter Robinson) - all: all ACPI platforms enable ATA_ACPI so move it to common (Peter Robinson) - all: x86: move shared x86 acpi config options to generic (Peter Robinson) - All: x86: Move ACPI_VIDEO to common/x86 (Peter Robinson) - All: x86: Enable ACPI_DPTF (Intel DPTF) (Peter Robinson) - All: enable ACPI_BGRT for all ACPI platforms. (Peter Robinson) - All: Only build ACPI_EC_DEBUGFS for debug kernels (Peter Robinson) - All: Disable Intel Classmate PC ACPI_CMPC option (Peter Robinson) - cleanup: ACPI_PROCFS_POWER was removed upstream (Peter Robinson) - All: ACPI: De-dupe the ACPI options that are the same across ark/fedora on x86/arm (Peter Robinson) - Enable the vkms module in Fedora (Jeremy Cline) - Fedora: arm updates for 5.11 and general cross Fedora cleanups (Peter Robinson) - Add gcc-c++ to BuildRequires (Justin M. Forbes) - Update CONFIG_KASAN_HW_TAGS (Justin M. Forbes) - fedora: arm: move generic power off/reset to all arm (Peter Robinson) - fedora: ARMv7: build in DEVFREQ_GOV_SIMPLE_ONDEMAND until I work out why it's changed (Peter Robinson) - fedora: cleanup joystick_adc (Peter Robinson) - fedora: update some display options (Peter Robinson) - fedora: arm: enable TI PRU options (Peter Robinson) - fedora: arm: minor exynos plaform updates (Peter Robinson) - arm: SoC: disable Toshiba Visconti SoC (Peter Robinson) - common: disable ARCH_BCM4908 (NFC) (Peter Robinson) - fedora: minor arm config updates (Peter Robinson) - fedora: enable Tegra 234 SoC (Peter Robinson) - fedora: arm: enable new Hikey 3xx options (Peter Robinson) - Fedora: USB updates (Peter Robinson) - fedora: enable the GNSS receiver subsystem (Peter Robinson) - Remove POWER_AVS as no longer upstream (Peter Robinson) - Cleanup RESET_RASPBERRYPI (Peter Robinson) - Cleanup GPIO_CDEV_V1 options. (Peter Robinson) - fedora: arm crypto updates (Peter Robinson) - CONFIG_KASAN_HW_TAGS for aarch64 (Justin M. Forbes) - Fedora: cleanup PCMCIA configs, move to x86 (Peter Robinson) - New configs in drivers/rtc (Fedora Kernel Team) - redhat/configs: Enable CONFIG_GCC_PLUGIN_STRUCTLEAK_BYREF_ALL (Josh Poimboeuf) [1856176] - redhat/configs: Enable CONFIG_GCC_PLUGIN_STRUCTLEAK (Josh Poimboeuf) [1856176] - redhat/configs: Enable CONFIG_GCC_PLUGINS on ARK (Josh Poimboeuf) [1856176] - redhat/configs: Enable CONFIG_KASAN on Fedora (Josh Poimboeuf) [1856176] - New configs in init/Kconfig (Fedora Kernel Team) - build_configs.sh: Fix syntax flagged by shellcheck (Ben Crocker) - genspec.sh: Fix syntax flagged by shellcheck (Ben Crocker) - mod-blacklist.sh: Fix syntax flagged by shellcheck (Ben Crocker) - Enable Speakup accessibility driver (Justin M. Forbes) - New configs in init/Kconfig (Fedora Kernel Team) - Fix fedora config mismatch due to dep changes (Justin M. Forbes) - New configs in drivers/crypto (Jeremy Cline) - Remove duplicate ENERGY_MODEL configs (Peter Robinson) - This is selected by PCIE_QCOM so must match (Justin M. Forbes) - drop unused BACKLIGHT_GENERIC (Peter Robinson) - Remove cp instruction already handled in instruction below. (Paulo E. Castro) - Add all the dependencies gleaned from running `make prepare` on a bloated devel kernel. (Paulo E. Castro) - Add tools to path mangling script. (Paulo E. Castro) - Remove duplicate cp statement which is also not specific to x86. (Paulo E. Castro) - Correct orc_types failure whilst running `make prepare` https://bugzilla.redhat.com/show_bug.cgi?id=1882854 (Paulo E. Castro) - redhat: ark: enable CONFIG_IKHEADERS (Jiri Olsa) - Add missing '$' sign to (GIT) in redhat/Makefile (Augusto Caringi) - Remove filterdiff and use native git instead (Don Zickus) - New configs in net/sched (Justin M. Forbes) - New configs in drivers/mfd (CKI@GitLab) - New configs in drivers/mfd (Fedora Kernel Team) - New configs in drivers/firmware (Fedora Kernel Team) - Temporarily backout parallel xz script (Justin M. Forbes) - redhat: explicitly disable CONFIG_IMA_APPRAISE_SIGNED_INIT (Bruno Meneguele) - redhat: enable CONFIG_EVM_LOAD_X509 on ARK (Bruno Meneguele) - redhat: enable CONFIG_EVM_ATTR_FSUUID on ARK (Bruno Meneguele) - redhat: enable CONFIG_EVM in all arches and flavors (Bruno Meneguele) - redhat: enable CONFIG_IMA_LOAD_X509 on ARK (Bruno Meneguele) - redhat: set CONFIG_IMA_DEFAULT_HASH to SHA256 (Bruno Meneguele) - redhat: enable CONFIG_IMA_SECURE_AND_OR_TRUSTED_BOOT (Bruno Meneguele) - redhat: enable CONFIG_IMA_READ_POLICY on ARK (Bruno Meneguele) - redhat: set default IMA template for all ARK arches (Bruno Meneguele) - redhat: enable CONFIG_IMA_DEFAULT_HASH_SHA256 for all flavors (Bruno Meneguele) - redhat: disable CONFIG_IMA_DEFAULT_HASH_SHA1 (Bruno Meneguele) - redhat: enable CONFIG_IMA_ARCH_POLICY for ppc and x86 (Bruno Meneguele) - redhat: enable CONFIG_IMA_APPRAISE_MODSIG (Bruno Meneguele) - redhat: enable CONFIG_IMA_APPRAISE_BOOTPARAM (Bruno Meneguele) - redhat: enable CONFIG_IMA_APPRAISE (Bruno Meneguele) - redhat: enable CONFIG_INTEGRITY for aarch64 (Bruno Meneguele) - kernel: Update some missing KASAN/KCSAN options (Jeremy Linton) - kernel: Enable coresight on aarch64 (Jeremy Linton) - Update CONFIG_INET6_ESPINTCP (Justin Forbes) - New configs in net/ipv6 (Justin M. Forbes) - fedora: move CONFIG_RTC_NVMEM options from ark to common (Peter Robinson) - configs: Enable CONFIG_DEBUG_INFO_BTF (Don Zickus) - fedora: some minor arm audio config tweaks (Peter Robinson) - Ship xpad with default modules on Fedora and RHEL (Bastien Nocera) - Fedora: Only enable legacy serial/game port joysticks on x86 (Peter Robinson) - Fedora: Enable the options required for the Librem 5 Phone (Peter Robinson) - Fedora config update (Justin M. Forbes) - Fedora config change because CONFIG_FSL_DPAA2_ETH now selects CONFIG_FSL_XGMAC_MDIO (Justin M. Forbes) - redhat: generic enable CONFIG_INET_MPTCP_DIAG (Davide Caratti) - Fedora config update (Justin M. Forbes) - Enable NANDSIM for Fedora (Justin M. Forbes) - Re-enable CONFIG_ACPI_TABLE_UPGRADE for Fedora since upstream disables this if secureboot is active (Justin M. Forbes) - Ath11k related config updates (Justin M. Forbes) - Fedora config updates for ath11k (Justin M. Forbes) - Turn on ATH11K for Fedora (Justin M. Forbes) - redhat: enable CONFIG_INTEL_IOMMU_SVM (Jerry Snitselaar) - More Fedora config fixes (Justin M. Forbes) - Fedora 5.10 config updates (Justin M. Forbes) - Fedora 5.10 configs round 1 (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Allow kernel-tools to build without selftests (Don Zickus) - Allow building of kernel-tools standalone (Don Zickus) - redhat: ark: disable CONFIG_NET_ACT_CTINFO (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_TEQL (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_SFB (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_QFQ (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_PLUG (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_PIE (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_HHF (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_DSMARK (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_DRR (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_CODEL (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_CHOKE (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_CBQ (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_ATM (Davide Caratti) - redhat: ark: disable CONFIG_NET_EMATCH and sub-targets (Davide Caratti) - redhat: ark: disable CONFIG_NET_CLS_TCINDEX (Davide Caratti) - redhat: ark: disable CONFIG_NET_CLS_RSVP6 (Davide Caratti) - redhat: ark: disable CONFIG_NET_CLS_RSVP (Davide Caratti) - redhat: ark: disable CONFIG_NET_CLS_ROUTE4 (Davide Caratti) - redhat: ark: disable CONFIG_NET_CLS_BASIC (Davide Caratti) - redhat: ark: disable CONFIG_NET_ACT_SKBMOD (Davide Caratti) - redhat: ark: disable CONFIG_NET_ACT_SIMP (Davide Caratti) - redhat: ark: disable CONFIG_NET_ACT_NAT (Davide Caratti) - arm64/defconfig: Enable CONFIG_KEXEC_FILE (Bhupesh Sharma) [1821565] - redhat/configs: Cleanup CONFIG_CRYPTO_SHA512 (Prarit Bhargava) - New configs in drivers/mfd (Fedora Kernel Team) - Fix LTO issues with kernel-tools (Don Zickus) - Point pathfix to the new location for gen_compile_commands.py (Justin M. Forbes) - configs: Disable CONFIG_SECURITY_SELINUX_DISABLE (Ondrej Mosnacek) - [Automatic] Handle config dependency changes (Don Zickus) - configs/iommu: Add config comment to empty CONFIG_SUN50I_IOMMU file (Jerry Snitselaar) - New configs in kernel/trace (Fedora Kernel Team) - Fix Fedora config locations (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - configs: enable CONFIG_CRYPTO_CTS=y so cts(cbc(aes)) is available in FIPS mode (Vladis Dronov) [1855161] - Partial revert: Add master merge check (Don Zickus) - Update Maintainers doc to reflect workflow changes (Don Zickus) - WIP: redhat/docs: Update documentation for single branch workflow (Prarit Bhargava) - Add CONFIG_ARM64_MTE which is not picked up by the config scripts for some reason (Justin M. Forbes) - Disable Speakup synth DECEXT (Justin M. Forbes) - Enable Speakup for Fedora since it is out of staging (Justin M. Forbes) - Modify patchlist changelog output (Don Zickus) - process_configs.sh: Fix syntax flagged by shellcheck (Ben Crocker) - generate_all_configs.sh: Fix syntax flagged by shellcheck (Ben Crocker) - redhat/self-test: Initial commit (Ben Crocker) - arch/x86: Remove vendor specific CPU ID checks (Prarit Bhargava) - redhat: Replace hardware.redhat.com link in Unsupported message (Prarit Bhargava) [1810301] - x86: Fix compile issues with rh_check_supported() (Don Zickus) - KEYS: Make use of platform keyring for module signature verify (Robert Holmes) - Input: rmi4 - remove the need for artificial IRQ in case of HID (Benjamin Tissoires) - ARM: tegra: usb no reset (Peter Robinson) - arm: make CONFIG_HIGHPTE optional without CONFIG_EXPERT (Jon Masters) - redhat: rh_kabi: deduplication friendly structs (Jiri Benc) - redhat: rh_kabi add a comment with warning about RH_KABI_EXCLUDE usage (Jiri Benc) - redhat: rh_kabi: introduce RH_KABI_EXTEND_WITH_SIZE (Jiri Benc) - redhat: rh_kabi: Indirect EXTEND macros so nesting of other macros will resolve. (Don Dutile) - redhat: rh_kabi: Fix RH_KABI_SET_SIZE to use dereference operator (Tony Camuso) - redhat: rh_kabi: Add macros to size and extend structs (Prarit Bhargava) - Removing Obsolete hba pci-ids from rhel8 (Dick Kennedy) [1572321] - mptsas: pci-id table changes (Laura Abbott) - mptsas: Taint kernel if mptsas is loaded (Laura Abbott) - mptspi: pci-id table changes (Laura Abbott) - qla2xxx: Remove PCI IDs of deprecated adapter (Jeremy Cline) - be2iscsi: remove unsupported device IDs (Chris Leech) [1574502 1598366] - mptspi: Taint kernel if mptspi is loaded (Laura Abbott) - hpsa: remove old cciss-based smartarray pci ids (Joseph Szczypek) [1471185] - qla4xxx: Remove deprecated PCI IDs from RHEL 8 (Chad Dupuis) [1518874] - aacraid: Remove depreciated device and vendor PCI id's (Raghava Aditya Renukunta) [1495307] - megaraid_sas: remove deprecated pci-ids (Tomas Henzl) [1509329] - mpt*: remove certain deprecated pci-ids (Jeremy Cline) - kernel: add SUPPORT_REMOVED kernel taint (Tomas Henzl) [1602033] - Rename RH_DISABLE_DEPRECATED to RHEL_DIFFERENCES (Don Zickus) - s390: Lock down the kernel when the IPL secure flag is set (Jeremy Cline) - efi: Lock down the kernel if booted in secure boot mode (David Howells) - efi: Add an EFI_SECURE_BOOT flag to indicate secure boot mode (David Howells) - security: lockdown: expose a hook to lock the kernel down (Jeremy Cline) - Make get_cert_list() use efi_status_to_str() to print error messages. (Peter Jones) - Add efi_status_to_str() and rework efi_status_to_err(). (Peter Jones) - Add support for deprecating processors (Laura Abbott) [1565717 1595918 1609604 1610493] - arm: aarch64: Drop the EXPERT setting from ARM64_FORCE_52BIT (Jeremy Cline) - iommu/arm-smmu: workaround DMA mode issues (Laura Abbott) - rh_kabi: introduce RH_KABI_EXCLUDE (Jakub Racek) [1652256] - ipmi: do not configure ipmi for HPE m400 (Laura Abbott) [1670017] - kABI: Add generic kABI macros to use for kABI workarounds (Myron Stowe) [1546831] - add pci_hw_vendor_status() (Maurizio Lombardi) [1590829] - ahci: thunderx2: Fix for errata that affects stop engine (Robert Richter) [1563590] - Vulcan: AHCI PCI bar fix for Broadcom Vulcan early silicon (Robert Richter) [1563590] - bpf: set unprivileged_bpf_disabled to 1 by default, add a boot parameter (Eugene Syromiatnikov) [1561171] - add Red Hat-specific taint flags (Eugene Syromiatnikov) [1559877] - tags.sh: Ignore redhat/rpm (Jeremy Cline) - put RHEL info into generated headers (Laura Abbott) [1663728] - aarch64: acpi scan: Fix regression related to X-Gene UARTs (Mark Salter) [1519554] - ACPI / irq: Workaround firmware issue on X-Gene based m400 (Mark Salter) [1519554] - modules: add rhelversion MODULE_INFO tag (Laura Abbott) - ACPI: APEI: arm64: Ignore broken HPE moonshot APEI support (Al Stone) [1518076] - Add Red Hat tainting (Laura Abbott) [1565704 1652266] - Introduce CONFIG_RH_DISABLE_DEPRECATED (Laura Abbott) - Stop merging ark-patches for release (Don Zickus) - Fix path location for ark-update-configs.sh (Don Zickus) - Combine Red Hat patches into single patch (Don Zickus) - New configs in drivers/misc (Jeremy Cline) - New configs in drivers/net/wireless (Justin M. Forbes) - New configs in drivers/phy (Fedora Kernel Team) - New configs in drivers/tty (Fedora Kernel Team) - Set SquashFS decompression options for all flavors to match RHEL (Bohdan Khomutskyi) - configs: Enable CONFIG_ENERGY_MODEL (Phil Auld) - New configs in drivers/pinctrl (Fedora Kernel Team) - Update CONFIG_THERMAL_NETLINK (Justin Forbes) - Separate merge-upstream and release stages (Don Zickus) - Re-enable CONFIG_IR_SERIAL on Fedora (Prarit Bhargava) - Create Patchlist.changelog file (Don Zickus) - Filter out upstream commits from changelog (Don Zickus) - Merge Upstream script fixes (Don Zickus) - kernel.spec: Remove kernel-keys directory on rpm erase (Prarit Bhargava) - Add mlx5_vdpa to module filter for Fedora (Justin M. Forbes) - Add python3-sphinx_rtd_theme buildreq for docs (Justin M. Forbes) - redhat/configs/process_configs.sh: Remove *.config.orig files (Prarit Bhargava) - redhat/configs/process_configs.sh: Add process_configs_known_broken flag (Prarit Bhargava) - redhat/Makefile: Fix '*-configs' targets (Prarit Bhargava) - dist-merge-upstream: Checkout known branch for ci scripts (Don Zickus) - kernel.spec: don't override upstream compiler flags for ppc64le (Dan Horák) - Fedora config updates (Justin M. Forbes) - Fedora confi gupdate (Justin M. Forbes) - mod-sign.sh: Fix syntax flagged by shellcheck (Ben Crocker) - Swap how ark-latest is built (Don Zickus) - Add extra version bump to os-build branch (Don Zickus) - dist-release: Avoid needless version bump. (Don Zickus) - Add dist-fedora-release target (Don Zickus) - Remove redundant code in dist-release (Don Zickus) - Makefile.common rename TAG to _TAG (Don Zickus) - Fedora config change (Justin M. Forbes) - Fedora filter update (Justin M. Forbes) - Config update for Fedora (Justin M. Forbes) - enable PROTECTED_VIRTUALIZATION_GUEST for all s390x kernels (Dan Horák) - redhat: ark: enable CONFIG_NET_SCH_TAPRIO (Davide Caratti) - redhat: ark: enable CONFIG_NET_SCH_ETF (Davide Caratti) - More Fedora config updates (Justin M. Forbes) - New config deps (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - First half of config updates for Fedora (Justin M. Forbes) - Updates for Fedora arm architectures for the 5.9 window (Peter Robinson) - Merge 5.9 config changes from Peter Robinson (Justin M. Forbes) - Add config options that only show up when we prep on arm (Justin M. Forbes) - Config updates for Fedora (Justin M. Forbes) - fedora: enable enery model (Peter Robinson) - Use the configs/generic config for SND_HDA_INTEL everywhere (Peter Robinson) - Enable ZSTD compression algorithm on all kernels (Peter Robinson) - Enable ARM_SMCCC_SOC_ID on all aarch64 kernels (Peter Robinson) - iio: enable LTR-559 light and proximity sensor (Peter Robinson) - iio: chemical: enable some popular chemical and partical sensors (Peter Robinson) - More mismatches (Justin M. Forbes) - Fedora config change due to deps (Justin M. Forbes) - CONFIG_SND_SOC_MAX98390 is now selected by SND_SOC_INTEL_DA7219_MAX98357A_GENERIC (Justin M. Forbes) - Config change required for build part 2 (Justin M. Forbes) - Config change required for build (Justin M. Forbes) - Fedora config update (Justin M. Forbes) - Add ability to sync upstream through Makefile (Don Zickus) - Add master merge check (Don Zickus) - Replace hardcoded values 'os-build' and project id with variables (Don Zickus) - redhat/Makefile.common: Fix MARKER (Prarit Bhargava) - gitattributes: Remove unnecesary export restrictions (Prarit Bhargava) - Add new certs for dual signing with boothole (Justin M. Forbes) - Update secureboot signing for dual keys (Justin M. Forbes) - fedora: enable LEDS_SGM3140 for arm configs (Peter Robinson) - Enable CONFIG_DM_VERITY_VERIFY_ROOTHASH_SIG (Justin M. Forbes) - redhat/configs: Fix common CONFIGs (Prarit Bhargava) - redhat/configs: General CONFIG cleanups (Prarit Bhargava) - redhat/configs: Update & generalize evaluate_configs (Prarit Bhargava) - fedora: arm: Update some meson config options (Peter Robinson) - redhat/docs: Add Fedora RPM tagging date (Prarit Bhargava) - Update config for renamed panel driver. (Peter Robinson) - Enable SERIAL_SC16IS7XX for SPI interfaces (Peter Robinson) - s390x-zfcpdump: Handle missing Module.symvers file (Don Zickus) - Fedora config updates (Justin M. Forbes) - redhat/configs: Add .tmp files to .gitignore (Prarit Bhargava) - disable uncommon TCP congestion control algorithms (Davide Caratti) - Add new bpf man pages (Justin M. Forbes) - Add default option for CONFIG_ARM64_BTI_KERNEL to pending-common so that eln kernels build (Justin M. Forbes) - redhat/Makefile: Add fedora-configs and rh-configs make targets (Prarit Bhargava) - redhat/configs: Use SHA512 for module signing (Prarit Bhargava) - genspec.sh: 'touch' empty Patchlist file for single tarball (Don Zickus) - Fedora config update for rc1 (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - redhat/Makefile.common: fix RPMKSUBLEVEL condition (Ondrej Mosnacek) - redhat/Makefile: silence KABI tar output (Ondrej Mosnacek) - One more Fedora config update (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fix PATCHLEVEL for merge window (Justin M. Forbes) - Change ark CONFIG_COMMON_CLK to yes, it is selected already by other options (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - More module filtering for Fedora (Justin M. Forbes) - Update filters for rnbd in Fedora (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fix up module filtering for 5.8 (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - More Fedora config work (Justin M. Forbes) - RTW88BE and CE have been extracted to their own modules (Justin M. Forbes) - Set CONFIG_BLK_INLINE_ENCRYPTION_FALLBACK for Fedora (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Arm64 Use Branch Target Identification for kernel (Justin M. Forbes) - Change value of CONFIG_SECURITY_SELINUX_CHECKREQPROT_VALUE (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fix configs for Fedora (Justin M. Forbes) - Add zero-commit to format-patch options (Justin M. Forbes) - Copy Makefile.rhelver as a source file rather than a patch (Jeremy Cline) - Move the sed to clear the patch templating outside of conditionals (Justin M. Forbes) - Match template format in kernel.spec.template (Justin M. Forbes) - Break out the Patches into individual files for dist-git (Justin M. Forbes) - Break the Red Hat patch into individual commits (Jeremy Cline) - Fix update_scripts.sh unselective pattern sub (David Howells) - Add cec to the filter overrides (Justin M. Forbes) - Add overrides to filter-modules.sh (Justin M. Forbes) - redhat/configs: Enable CONFIG_SMC91X and disable CONFIG_SMC911X (Prarit Bhargava) [1722136] - Include bpftool-struct_ops man page in the bpftool package (Jeremy Cline) - Add sharedbuffer_configuration.py to the pathfix.py script (Jeremy Cline) - Use __make macro instead of make (Tom Stellard) - Sign off generated configuration patches (Jeremy Cline) - Drop the static path configuration for the Sphinx docs (Jeremy Cline) - redhat: Add dummy-module kernel module (Prarit Bhargava) - redhat: enable CONFIG_LWTUNNEL_BPF (Jiri Benc) - Remove typoed config file aarch64CONFIG_SM_GCC_8150 (Justin M. Forbes) - Add Documentation back to kernel-devel as it has Kconfig now (Justin M. Forbes) - Copy distro files rather than moving them (Jeremy Cline) - kernel.spec: fix 'make scripts' for kernel-devel package (Brian Masney) - Makefile: correct help text for dist-cross--rpms (Brian Masney) - redhat/Makefile: Fix RHEL8 python warning (Prarit Bhargava) - redhat: Change Makefile target names to dist- (Prarit Bhargava) - configs: Disable Serial IR driver (Prarit Bhargava) - Fix "multiple %files for package kernel-tools" (Pablo Greco) - Introduce a Sphinx documentation project (Jeremy Cline) - Build ARK against ELN (Don Zickus) - Drop the requirement to have a remote called linus (Jeremy Cline) - Rename 'internal' branch to 'os-build' (Don Zickus) - Only include open merge requests with "Include in Releases" label (Jeremy Cline) - Package gpio-watch in kernel-tools (Jeremy Cline) - Exit non-zero if the tag already exists for a release (Jeremy Cline) - Adjust the changelog update script to not push anything (Jeremy Cline) - Drop --target noarch from the rh-rpms make target (Jeremy Cline) - Add a script to generate release tags and branches (Jeremy Cline) - Set CONFIG_VDPA for fedora (Justin M. Forbes) - Add a README to the dist-git repository (Jeremy Cline) - Provide defaults in ark-rebase-patches.sh (Jeremy Cline) - Default ark-rebase-patches.sh to not report issues (Jeremy Cline) - Drop DIST from release commits and tags (Jeremy Cline) - Place the buildid before the dist in the release (Jeremy Cline) - Sync up with Fedora arm configuration prior to merging (Jeremy Cline) - Disable CONFIG_PROTECTED_VIRTUALIZATION_GUEST for zfcpdump (Jeremy Cline) - Add RHMAINTAINERS file and supporting conf (Don Zickus) - Add a script to test if all commits are signed off (Jeremy Cline) - Fix make rh-configs-arch (Don Zickus) - Drop RH_FEDORA in favor of the now-merged RHEL_DIFFERENCES (Jeremy Cline) - Sync up Fedora configs from the first week of the merge window (Jeremy Cline) - Migrate blacklisting floppy.ko to mod-blacklist.sh (Don Zickus) - kernel packaging: Combine mod-blacklist.sh and mod-extra-blacklist.sh (Don Zickus) - kernel packaging: Fix extra namespace collision (Don Zickus) - mod-extra.sh: Rename to mod-blacklist.sh (Don Zickus) - mod-extra.sh: Make file generic (Don Zickus) - Fix a painfully obvious YAML syntax error in .gitlab-ci.yml (Jeremy Cline) - Add in armv7hl kernel header support (Don Zickus) - Disable all BuildKernel commands when only building headers (Don Zickus) - Drop any gitlab-ci patches from ark-patches (Jeremy Cline) - Build the srpm for internal branch CI using the vanilla tree (Jeremy Cline) - Pull in the latest ARM configurations for Fedora (Jeremy Cline) - Fix xz memory usage issue (Neil Horman) - Use ark-latest instead of master for update script (Jeremy Cline) - Move the CI jobs back into the ARK repository (Jeremy Cline) - Sync up ARK's Fedora config with the dist-git repository (Jeremy Cline) - Pull in the latest configuration changes from Fedora (Jeremy Cline) - configs: enable CONFIG_NET_SCH_CBS (Marcelo Ricardo Leitner) - Drop configuration options in fedora/ that no longer exist (Jeremy Cline) - Set RH_FEDORA for ARK and Fedora (Jeremy Cline) - redhat/kernel.spec: Include the release in the kernel COPYING file (Jeremy Cline) - redhat/kernel.spec: add scripts/jobserver-exec to py3_shbang_opts list (Jeremy Cline) - redhat/kernel.spec: package bpftool-gen man page (Jeremy Cline) - distgit-changelog: handle multiple y-stream BZ numbers (Bruno Meneguele) - redhat/kernel.spec: remove all inline comments (Bruno Meneguele) - redhat/genspec: awk unknown whitespace regex pattern (Bruno Meneguele) - Improve the readability of gen_config_patches.sh (Jeremy Cline) - Fix some awkward edge cases in gen_config_patches.sh (Jeremy Cline) - Update the CI environment to use Fedora 31 (Jeremy Cline) - redhat: drop whitespace from with_gcov macro (Jan Stancek) - configs: Enable CONFIG_KEY_DH_OPERATIONS on ARK (Ondrej Mosnacek) - configs: Adjust CONFIG_MPLS_ROUTING and CONFIG_MPLS_IPTUNNEL (Laura Abbott) - New configs in lib/crypto (Jeremy Cline) - New configs in drivers/char (Jeremy Cline) - Turn on BLAKE2B for Fedora (Jeremy Cline) - kernel.spec.template: Clean up stray *.h.s files (Laura Abbott) - Build the SRPM in the CI job (Jeremy Cline) - New configs in net/tls (Jeremy Cline) - New configs in net/tipc (Jeremy Cline) - New configs in lib/kunit (Jeremy Cline) - Fix up released_kernel case (Laura Abbott) - New configs in lib/Kconfig.debug (Jeremy Cline) - New configs in drivers/ptp (Jeremy Cline) - New configs in drivers/nvme (Jeremy Cline) - New configs in drivers/net/phy (Jeremy Cline) - New configs in arch/arm64 (Jeremy Cline) - New configs in drivers/crypto (Jeremy Cline) - New configs in crypto/Kconfig (Jeremy Cline) - Add label so the Gitlab to email bridge ignores the changelog (Jeremy Cline) - Temporarily switch TUNE_DEFAULT to y (Jeremy Cline) - Run config test for merge requests and internal (Jeremy Cline) - Add missing licensedir line (Laura Abbott) - redhat/scripts: Remove redhat/scripts/rh_get_maintainer.pl (Prarit Bhargava) - configs: Take CONFIG_DEFAULT_MMAP_MIN_ADDR from Fedra (Laura Abbott) - configs: Turn off ISDN (Laura Abbott) - Add a script to generate configuration patches (Laura Abbott) - Introduce rh-configs-commit (Laura Abbott) - kernel-packaging: Remove kernel files from kernel-modules-extra package (Prarit Bhargava) - configs: Enable CONFIG_DEBUG_WX (Laura Abbott) - configs: Disable wireless USB (Laura Abbott) - Clean up some temporary config files (Laura Abbott) - configs: New config in drivers/gpu for v5.4-rc1 (Jeremy Cline) - configs: New config in arch/powerpc for v5.4-rc1 (Jeremy Cline) - configs: New config in crypto for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/usb for v5.4-rc1 (Jeremy Cline) - AUTOMATIC: New configs (Jeremy Cline) - Skip ksamples for bpf, they are broken (Jeremy Cline) - configs: New config in fs/erofs for v5.4-rc1 (Jeremy Cline) - configs: New config in mm for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/md for v5.4-rc1 (Jeremy Cline) - configs: New config in init for v5.4-rc1 (Jeremy Cline) - configs: New config in fs/fuse for v5.4-rc1 (Jeremy Cline) - merge.pl: Avoid comments but do not skip them (Don Zickus) - configs: New config in drivers/net/ethernet/pensando for v5.4-rc1 (Jeremy Cline) - Update a comment about what released kernel means (Laura Abbott) - Provide both Fedora and RHEL files in the SRPM (Laura Abbott) - kernel.spec.template: Trim EXTRAVERSION in the Makefile (Laura Abbott) - kernel.spec.template: Add macros for building with nopatches (Laura Abbott) - kernel.spec.template: Add some macros for Fedora differences (Laura Abbott) - kernel.spec.template: Consolodate the options (Laura Abbott) - configs: Add pending direcory to Fedora (Laura Abbott) - kernel.spec.template: Don't run hardlink if rpm-ostree is in use (Laura Abbott) - configs: New config in net/can for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/net/phy for v5.4-rc1 (Jeremy Cline) - configs: Increase x86_64 NR_UARTS to 64 (Prarit Bhargava) [1730649] - configs: turn on ARM64_FORCE_52BIT for debug builds (Jeremy Cline) - kernel.spec.template: Tweak the python3 mangling (Laura Abbott) - kernel.spec.template: Add --with verbose option (Laura Abbott) - kernel.spec.template: Switch to using %install instead of %__install (Laura Abbott) - kernel.spec.template: Make the kernel.org URL https (Laura Abbott) - kernel.spec.template: Update message about secure boot signing (Laura Abbott) - kernel.spec.template: Move some with flags definitions up (Laura Abbott) - kernel.spec.template: Update some BuildRequires (Laura Abbott) - kernel.spec.template: Get rid of %clean (Laura Abbott) - configs: New config in drivers/char for v5.4-rc1 (Jeremy Cline) - configs: New config in net/sched for v5.4-rc1 (Jeremy Cline) - configs: New config in lib for v5.4-rc1 (Jeremy Cline) - configs: New config in fs/verity for v5.4-rc1 (Jeremy Cline) - configs: New config in arch/aarch64 for v5.4-rc4 (Jeremy Cline) - configs: New config in arch/arm64 for v5.4-rc1 (Jeremy Cline) - Flip off CONFIG_ARM64_VA_BITS_52 so the bundle that turns it on applies (Jeremy Cline) - New configuration options for v5.4-rc4 (Jeremy Cline) - Correctly name tarball for single tarball builds (Laura Abbott) - configs: New config in drivers/pci for v5.4-rc1 (Jeremy Cline) - Allow overriding the dist tag on the command line (Laura Abbott) - Allow scratch branch target to be overridden (Laura Abbott) - Remove long dead BUILD_DEFAULT_TARGET (Laura Abbott) - Amend the changelog when rebasing (Laura Abbott) - configs: New config in drivers/platform for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/pinctrl for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/net/wireless for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/net/ethernet/mellanox for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/net/can for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/hid for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/dma-buf for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/crypto for v5.4-rc1 (Jeremy Cline) - configs: New config in arch/s390 for v5.4-rc1 (Jeremy Cline) - configs: New config in block for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/cpuidle for v5.4-rc1 (Jeremy Cline) - redhat: configs: Split CONFIG_CRYPTO_SHA512 (Laura Abbott) - redhat: Set Fedora options (Laura Abbott) - Set CRYPTO_SHA3_*_S390 to builtin on zfcpdump (Jeremy Cline) - configs: New config in drivers/edac for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/firmware for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/hwmon for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/iio for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/mmc for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/tty for v5.4-rc1 (Jeremy Cline) - configs: New config in arch/s390 for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/bus for v5.4-rc1 (Jeremy Cline) - Add option to allow mismatched configs on the command line (Laura Abbott) - configs: New config in drivers/crypto for v5.4-rc1 (Jeremy Cline) - configs: New config in sound/pci for v5.4-rc1 (Jeremy Cline) - configs: New config in sound/soc for v5.4-rc1 (Jeremy Cline) - gitlab: Add CI job for packaging scripts (Major Hayden) - Speed up CI with CKI image (Major Hayden) - Disable e1000 driver in ARK (Neil Horman) - configs: Fix the pending default for CONFIG_ARM64_VA_BITS_52 (Jeremy Cline) - configs: Turn on OPTIMIZE_INLINING for everything (Jeremy Cline) - configs: Set valid pending defaults for CRYPTO_ESSIV (Jeremy Cline) - Add an initial CI configuration for the internal branch (Jeremy Cline) - New drop of configuration options for v5.4-rc1 (Jeremy Cline) - New drop of configuration options for v5.4-rc1 (Jeremy Cline) - Pull the RHEL version defines out of the Makefile (Jeremy Cline) - Sync up the ARK build scripts (Jeremy Cline) - Sync up the Fedora Rawhide configs (Jeremy Cline) - Sync up the ARK config files (Jeremy Cline) - configs: Adjust CONFIG_FORCE_MAX_ZONEORDER for Fedora (Laura Abbott) - configs: Add README for some other arches (Laura Abbott) - configs: Sync up Fedora configs (Laura Abbott) - [initial commit] Add structure for building with git (Laura Abbott) - [initial commit] Add Red Hat variables in the top level makefile (Laura Abbott) - [initial commit] Red Hat gitignore and attributes (Laura Abbott) - [initial commit] Add changelog (Laura Abbott) - [initial commit] Add makefile (Laura Abbott) - [initial commit] Add files for generating the kernel.spec (Laura Abbott) - [initial commit] Add rpm directory (Laura Abbott) - [initial commit] Add files for packaging (Laura Abbott) - [initial commit] Add kabi files (Laura Abbott) - [initial commit] Add scripts (Laura Abbott) - [initial commit] Add configs (Laura Abbott) - [initial commit] Add Makefiles (Laura Abbott) - Linux v6.14.0-0.rc0.95ec54a420b8/bin/sh/bin/sh  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc6.14.8-400.asahi.el96.14.8-400.asahi.el96.14.8-400.asahi.el9++16k6.14.8-400.asahi.el96.14.8-400.asahi.el96.14.8-400.asahi.el9++16k6.14.8-400.asahi.el9.aarch64++16k     !""##""$%""&&&&&""""'""""((""""""""""""")""""""""""""""""""!****+,,---./0000000011111100000022222200000000000033444444444435536666667787777777799:;:<<<===>???@@@@?AA>BBBBB>>C>DDDDD>>E>FFFFFFFFFFFFFFFFFFFFF>GGHGGIGGGJJGGKGLLLGMMGNNGOOGPPGQQQQGRRG>S>T>>UUUU>>VVVVVVVVWWWVVVVVVVVVV>XYYZZZZZZZZZZZZ[[\\\\]]\\^\__``````````a`bb_cccccc_ddddddedffdggdhdddiiiidjjjddkkdlllllmmlddnddoooodppdqdrrrdssssssssssssssddttttuutdvvwvvvddxdydzddd{ddd|d}}}}d~~ddddddddddddddd____________________rxrpc-blacklist.confarcharm64cryptocryptoasymmetric_keysasync_txdriversaccelqaicaccessibilityspeakupacpiapeinfitataauxdisplaybaseregmaptestbcmablockaoedrbdnull_blkrnbdzrambluetoothbusmhihostcdxcontrollercharhw_randomipmitpmxillybusclkbcmhisiliconimxkeystoneqcomxilinxcountercpufreqcryptoallwinnersun4i-sssun8i-cesun8i-sscaamcaviumcptnitroxzipccpchelsiohisiliconhpretrnginside-secureintelqatqat_420xxqat_4xxxqat_c3xxxqat_c3xxxvfqat_c62xqat_c62xvfqat_commonqat_dh895xccqat_dh895xccvfmarvellcesaocteontxocteontx2qcerockchiptegravirtioxilinxcxlcoredaxhmemdevfreqeventdmaamdqdmadwdw-axi-dmacdw-edmafsl-dpaa2-qdmaqcomshtixilinxedacextconfirmwarearm_ffaarm_scmitransportsvendorsimxcirrustestefistmmtestimxfpgagnssgpiogpudrmadpamdamdgpuamdxcpapplearmdisplaykomedaastbridgeadv7511analogixcadenceimxsynopsysdisplayetnavivgudhisiliconkirinhypervi2cimaginationimxdcsslcdclimamesonmgag200msmmxsfbnouveaupanelpanfrostpanthorpl111qxlradeonrenesasrz-durockchipschedulersolomonsun4itegrateststidsstinyttmudlv3dvc4vgemvirtiovkmsvmwgfxxexlnxhost1xhiddockchannel-hidi2c-hidspi-hidsurface-hidhtehvhwmonpmbushwspinlockhwtracingcoresightstmi2calgosbussesmuxesi3cmastermipi-i3c-hciiioacceladcaddacafeamplifiersbufferchemicalcommoncros_ec_sensorshid-sensorsinv_sensorsms_sensorsscmi_sensorsst_sensorsdacfrequencygyrohealthhumidityimubmi160bmi270bno055inv_icm42600inv_mpu6050st_lsm6dsxlightmagnetometermultiplexerorientationpositionpotentiometerpotentiostatpressureproximitytemperaturetesttriggerinfinibandcorehwcxgb4efaerdmairdmamanamlx4mlx5mthcaocrdmaqedrswrxesiwulpipoibiserisertrtrssrpsrptinputgameportjoystickiforcekeyboardmiscmousermi4seriotabletteststouchscreeninterconnectimxqcomiommuarmarm-smmu-v3iommufdirqchipledsflashrgbtriggermailboxmdbcachedm-vdopersistent-datamediaceccorei2cplatformcec-gpiocros-ecmesontegrausbpulse8rainshadowcommonb2c2saa7146sianov4l2-tpgvideobuf2dvb-coredvb-frontendsdrx39xyji2cadv748xccscx25840et8ek8s5c73m3mcmmcsianopcib2c2bt8xxcx18cx23885cx88ddbridgedm1105intelivtvmantisnetup_unidvbngenepluto2pt1saa7134saa7146saa7164smipciesolo6x10ttpcitw686xplatformallegro-dvtamlogicmeson-ge2damphionappleispbroadcomcadencechips-mediacodawave5imaginationnvidiategra-vdenxpdw100imx-jpegimx8-isiqcomcamssvenusraspberrypipisp_berp1-cferenesasrzg2l-cruvsp1rockchiprgarkisp1sunxisun4i-csisun6i-csisun8i-disun8i-rotateticalj721e-csi2rxverisiliconradiosi470xrckeymapsspitest-driversvicodecvimcvislvividtunersusbas102au0828cx231xxdvb-usbdvb-usb-v2em28xxgo7007gspcagl860m5602stv06xxhdpvrpvrusb2pwcs2255sianostk1160ttusb-budgetttusb-decusbtvuvcv4l2-corememorytegramemstickcorehostmfdmiscaltera-staplbcm-vkcardreadercb710echoeepromkebalis3lv02dmchp_pci1xxxxpvpanicuaccevmw_vmcimmccorehostmtdchipsdevicesmapsnandrawspiparsersspi-norcontrollersubimuxnetbondingcanctucanfddevflexcanifi_canfdm_canpeak_canfdrcarrockchipslcanspimcp251xfdusbkvaser_usbpeak_usbdsab53hirschmannmv88e6xxxqcarealtekxrs700xethernet8390adiagerealteonalteraamazonenaamdpds_corexgbeapmxgenexgene-v2aquantiaatlanticarcasixatherosalxatl1catl1eatlxbroadcombnx2xbnxtgenetcadencecaviumcommonthunderchelsiocxgbcxgb3cxgb4cxgb4vfinline_cryptoch_ipsecch_ktlslibcxgbdlinkemulexbenetenglederfreescaledpaadpaa2enetcfmanfungiblefuncorefunethgooglegvehisiliconhibmcgehnshns3intele1000e1000efm10ki40eiavficeidpfigbigbvfigcixgbeixgbevflibethlibielitexmarvellmvpp2octeon_epocteon_ep_vfocteontx2afnicpresteramellanoxmlx4mlx5coremlxbf_gigemlxfwmlxswmicrelmicrochiplan966xmicrosoftmanamyricommyri10genatsemineterionnetronomenfpnvidiapacketenginespensandoionicqlogicnetxenqedqedeqlcnicqualcommemacrmnetrdcrealtekrenesasrockersilansissmscsocionextstmicrostmmactehutitiicssgvertexcomviawangxunlibwxngbetxgbexilinxhamradiohypervieee802154ipaipvlanmctpmdionetdevsimpcsphyaquantiamediatekmsccqcomrealtekpppslipteamthunderboltusbvmxnet3vxlanwireguardwirelessathar5523ath10kath11kath12kath5kath6klath9kcarl9170wcn36xxwil6210broadcomb43b43legacybrcm80211brcmfmacbcacywwccbrcmsmacbrcmutilinteliwlegacyiwlwifidvmmvmteststestsmarvelllibertas_tfmwifiexmediatekmt76mt7603mt7615mt76x0mt76x2mt7915mt7921mt7925mt7996mt7601uquantennaqtnfmacralinkrt2x00realtekrtl818xrtl8180rtl8187rtl8xxxurtlwifibtcoexistrtl8188eertl8192crtl8192certl8192drtl8192dertl8192durtl8192eertl8192sertl8723aertl8723bertl8723comrtl8821aertw88rtw89rsistcw1200tiwl1251wl12xxwl18xxwlcorevirtualzydaszd1211rwwwaniosmt7xxnfcmicroreadnfcmrvlnxp-ncipn533pn544st21nfcanvmecommonhosttargetnvmemlayoutsofpcicontrollerhotplugpciepwrctrlswitchperfamlogicarm_cspmuphyallwinneramlogicapplecadencefreescalehisiliconmarvellqualcommrenesasrockchiptegratixilinxpinctrlcirrusqcomplatformapplearm64chromemellanoxsurfaceaggregatorpmdomainarmimxqcomtipowerresetsequencingsupplypowercapppsclientsgeneratorsptppwmrapidiodevicesswitchesregulatorremoteprocresetamlogichisiliconrpmsgrtcscsiarcmsrbe2iscsibnx2fcbnx2icsiostorcxgbicxgb3icxgb4idevice_handlerelxesas2rfcoelibfclibsaslpfcmegaraidmpi3mrmpt3sasmvsasqedfqediqla2xxxqla4xxxsmartpqisnicsym53c8xx_2slimbussocamlogicapplefsldpioimxnuvotonqcomrockchiptisoundwirespispmissbstagingmediamax96712mesonvdecrkvdecsunxicedrussun6i-isptegra-videortl8723bsvc04_servicesbcm2835-audiobcm2835-cameravchiq-mmaltargetiscsicxgbitloopbacktcm_fctcm_remoteteeopteetsteethermalbroadcomqcomrenesastegrattyserial8250jsmufscorehostuiousbatmcdns3chipideaclasscommoncoredwc2dwc3gadgetfunctionlegacyudccdns2hostimageisp1760miscsisusbvgamusbphyserialstoragetypecaltmodesmuxtcpmqcomtipducsiusbipvdpaifcvfmlx5octeon_eppdssolidrunvdpa_simvirtio_pcivfiocdxfsl-mcpcimlx5nvgrace-gpupdsqatvirtioplatformresetvhostvideobacklightvirtcocoarm-cca-guestnitro_enclavesvboxguestvirtiow1mastersslaveswatchdogfs9pafsbcachefscachefilescephdlmecryptfserofsexfatext4f2fsfatfusegfs2hfshfsplusisofsjffs2jfslockdminixnetfsnfsblocklayoutfilelayoutflexfilelayoutnfs_commonnfsdnilfs2nlsntfs3orangefsoverlayfspstoreromfssmbclientcommonsquashfsubifsudfufsvboxsfxfszonefskernelbpfpreloadlockingrcutimetracelibcryptokunitlz4mathtestsreed_solomonmmkfencenet6lowpan8028021q9pappletalkatmax25batman-advbluetoothbnephidprfcommbridgenetfiltercanj1939cephcoredns_resolverdsahandshakehsrieee8021546lowpanifeipv4netfilteripv6ilanetfilterkcmkeyl2tpllcmac80211testsmac802154mplsmptcpnetfilteripsetipvsnetromnfchcincinshopenvswitchpsampleqrtrrfkillroserxrpcschedsctpsmcsunrpcauth_gssxprtrdmatipctlsvmw_vsockwirelesstestsxdpxfrmsoundcoreossseqossdriversmpu401opl3vxhdaexti2cotherpciac97au88x0ca0106cs46xxctxfiechoaudioemu10k1hdaice1712korg1212lolalx6464esmixartnm256oxygenpcxhrriptiderme9652tridentvx222ymfpcisocadiapplebcmcodecsdwcfslgenericgooglehisiliconmesonqcomqdsp6renesasrockchipsofimxxtensasunxitegratixilinxsynthemuxusb6firebcd2000caiaqhifaceline6miscvirtiopartnerkafs.ko.xzrxrpc.ko.xz/etc/modprobe.d//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/arch//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/arch/arm64//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/crypto//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/accel//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/accessibility//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/acpi//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/base//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/block//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/bus//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/bus/mhi//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/cdx//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/char//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/clk//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/crypto//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/crypto/allwinner//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/crypto/cavium//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/crypto/hisilicon//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/crypto/intel//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/crypto/intel/qat//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/crypto/marvell//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/cxl//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/dax//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/devfreq//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/dma//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/dma/amd//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/firmware//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/firmware/arm_scmi//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/firmware/arm_scmi/vendors//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/firmware/cirrus//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/firmware/efi//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm/amd//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm/arm//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm/arm/display//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm/bridge//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm/hisilicon//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm/imx//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm/renesas//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/hid//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/hwmon//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/hwtracing//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/i2c//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/i3c//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/i3c/master//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/iio//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/iio/common//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/iio/imu//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/infiniband//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/infiniband/hw//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/infiniband/sw//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/infiniband/ulp//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/input//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/input/joystick//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/interconnect//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/iommu//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/iommu/arm//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/leds//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/md//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/cec//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/cec/platform//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/cec/usb//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/common//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/dvb-frontends//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/i2c//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/mmc//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/pci//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/amlogic//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/apple//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/chips-media//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/nvidia//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/nxp//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/qcom//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/raspberrypi//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/renesas//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/rockchip//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/sunxi//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/ti//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/radio//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/rc//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/test-drivers//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/usb//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/usb/gspca//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/memory//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/memstick//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/misc//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/mmc//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/mtd//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/mtd/nand//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/mtd/spi-nor//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/can//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/can/spi//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/can/usb//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/dsa//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/amazon//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/amd//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/apm//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/aquantia//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/atheros//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/broadcom//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/cavium//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/chelsio//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/chelsio/inline_crypto//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/emulex//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/freescale//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/fungible//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/google//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/hisilicon//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/intel//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/marvell//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/marvell/octeontx2//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/mellanox//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/mellanox/mlx5//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/microchip//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/microsoft//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/myricom//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/netronome//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/pensando//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/qlogic//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/qualcomm//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/stmicro//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/ti//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/wangxun//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/phy//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/ath//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/broadcom//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/broadcom/brcm80211//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/broadcom/brcm80211/brcmfmac//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/intel//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/intel/iwlwifi//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/intel/iwlwifi/mvm//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/marvell//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/mediatek//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/mediatek/mt76//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/quantenna//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/ralink//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/realtek//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/realtek/rtl818x//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/realtek/rtlwifi//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/st//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/ti//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/zydas//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wwan//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/nfc//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/nvme//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/nvmem//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/pci//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/perf//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/phy//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/pinctrl//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/platform//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/platform/surface//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/pmdomain//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/power//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/pps//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/rapidio//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/reset//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/scsi//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/scsi/cxgbi//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/soc//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/soc/fsl//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/staging//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/staging/media//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/staging/media/meson//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/staging/media/sunxi//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/staging/vc04_services//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/target//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/target/iscsi//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/tee//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/thermal//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/tty//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/tty/serial//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/ufs//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/usb//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/usb/gadget//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/usb/gadget/udc//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/usb/misc//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/usb/typec//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/usb/typec/tcpm//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/vdpa//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/vfio//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/vfio/pci//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/vfio/platform//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/video//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/virt//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/virt/coco//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/drivers/w1//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/fs//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/fs/nfs//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/fs/smb//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/kernel//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/kernel/bpf//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/lib//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/lib/math//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/mm//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/net//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/net/bluetooth//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/net/bridge//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/net/can//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/net/ieee802154//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/net/ipv4//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/net/ipv6//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/net/mac80211//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/net/netfilter//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/net/nfc//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/net/sunrpc//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/net/wireless//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/sound//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/sound/core//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/sound/core/seq//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/sound/drivers//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/sound/hda//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/sound/i2c//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/sound/pci//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/sound/soc//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/sound/soc/qcom//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/sound/soc/sof//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/sound/synth//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/kernel/sound/usb//lib/modules/6.14.8-400.asahi.el9.aarch64+16k//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/partner/fs/afs//lib/modules/6.14.8-400.asahi.el9.aarch64+16k/partner/net/rxrpc/-O2 -fexceptions -g -grecord-gcc-switches -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -fstack-protector-strong -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -fasynchronous-unwind-tables -fstack-clash-protectioncpioxz3Taarch64-redhat-linux-gnuASCII textdirectoryELF 64-bit LSB relocatable, ARM aarch64, version 1 (SYSV) (XZ compressed data)PP P P utf-84fb1b667fca2c22f58686fca97812376bd07eeafac00c58bad298c4e7372c50423bd851bbd2e975b946e393ef35310054481d31476768532a8bf7120f0c5cc8e? 7zXZ Ⱦ!ǖ/s] b2u Q{L\)33;J+5mk!»HVXjA}Zd ݑhŶTp_uuE1J`x+:U&oZ} hЙ3;R3c"$TM\hlֿ%+1.@4:"1,$Ϫ^ aUI'\kCLY y0؅;hK =<7csBfK#[]+c5B<uYrc nog_"ʩ>B<ݫzܛo[ǀ팏2G6Q) F˥4J';9-|[ʟQs[cG6%qdDv:mbMB F0'~9_AIp?6 QԷW6$1 1 r0{aXMydpnrFF3+d9ܱP)']H_:聊mI:ڃmQY\Sf!+h<]SI?(ÿ+E 6A{<K0!?ZϙR+%[K$TTBD?;'Iko|i,K=r5 D ymغ2YVuK(r5FX6sd:Uγ2O^?lr6$ cwxK׶r\?PY~h Q6YMǵ,u?̻q!e_,%m̸f9M8Ԝd&=52!C IqSΘ:* Q"?d 2yI70X%E 4>7ұLղ֚@,'V:`ޓJUSR{pIn`ׇxn&o[DdqjE6=Rp)qqZYDiY;8nY۠ }JW#ڶsW|$9_WUh 0`49>CD 16:>+3@ u4NkU1+AGdzqBⶵ$,T}[o pܵHjU[RuTݎfj>/K-ԹTO,Z\Yz䄖3}>W>e+vJxR,-ܲ_j4@Uc<ָEP*%Ѕ6PrWc4*5EK7tuyѸ(Tv1R4 *@^!+JPW orYߛ5DK:[6(.G2R 8b]L9R/!kPJ59ׇϛZM P91jъ#u(Sgx&,lfNh=MTQ*0iPD 2"lңWAm}sF{Ki.s ,I}]*f+6rѲ^8hibG",q'Sg (ivkis5mwH1h&I/xg4>7᷻QM#c$WC(9Kmb;be ntwE@D;Q'X )"mn:tax24BH / B;C:Zp{!X[T0@ d5:ɴv-mj~o9^آ>D$ U"Ť&Pc8Nփl[7*-"ejO@rN3(Ee3(ճ,!# {4 v7cXs;?CJfu[iVB@7@M^i:UIDF*pvP"OhP#@=hRt*mB 0 zSCk  ۵~Pb-5qVS:ߍ(m@~}jzbTpkПI31Yy,~!؊R@*G'iae{eooUBعɡzYXGliO~h`~'3g Yp8)ߝxPHSB}tQ"z0N cP4.\Ã1=Ƿ_Vd) j%IL,Հmc$,aQ7ӈOvQۗ:mXMqEHjvdrg%04+N5LEoSP/' Sy1D>7‘kN"s3M0+ e{KXC HB/:t߇cH{ 3]4o=xr`"W5~(#tx(VBv_/)tM9ݍo:0f"<+ɋv  n q٪ձN~S棣eD5FPIs)ґA| vZSpd4\̳z'ٽE[*/ؓswa !10kuqGπk7r"-j&~n=U%p ;9O~{-\cvq\c#TE&BVIbIEDY ]t55nGLSHAp559&}[ ƻmWb;UZ~Vz'^, 8s58d7]փڇtcŖcwrC9>b@D~#,,`O^,6U`j t|Q!хlTSq7Y摩w8[v ?fxX"=kV"i5JDqR Cõ_Bxv1RmwM./nP 4xd/f0!Z݇yzIyCa {TMK":6SFL{^:.I2W&ZDAoVB\ZtFڜz|y ~;e٪=RJ|łqփDYfЄ#u-C(JLt'Z:Zn:FUx,gο@MJI*!d - *`_J6CɿKNFUgU6gBם7I'o0X(bV_+fLָ5fD]>vUwtTωj7>pDSlr!2:Z(wC|KPqR˯u>~9U#M*FS$ 1bl /\i7ǂ#8O}jX>b83AQ9TC}zUwYthOL;[J+<r"/^8C׀%;VȨ4pomܰfʻ fuajppYݍd+ 3U+JLg!l,A`ܥh`LN׽#@}Vc|Un0P>S6 ǕvՈr.҉OB> XOi0p>ʟ=xаW23)Qvxk<6t[B<ȪcSQ;)0^'ayaqepu[e9)I {LmHt;,ks8neP%E_˽U~i'gw0IkvѵrRυOYa _#wG[( mL/­bE!5l/?)n-0ߴo@YCz[PjZI4b[KZ#2 ^Izb~ Otf[@ @Y,\,X,eIuf> ٌUnn$yY75p"!CҰ<nd/} E*[li}+X w yK%.F'b@Q2NS4QJa"Ds8&MERQ;ccX\M(} e5C@j m.[jMu(q n5d )+_` sTk\>؀]/ųzbex@ݸ1?.sR5$}I#*qV+C"kt"ĝ1ơhkCޮk+*}]҃H?m:7dЊΛrtáuuoaZ7'U$6s+AeZ^.%?#qtdr1ܟ5hl1(ajk_N=b1s%ӬkUb-$B gkړ[o1i!:\btVzPQ +HU9nu;ҩ^PZ_&{Lo51P[g L~rRtdS7B=j,vcQ}yHQ6LyyTAW7 *|x6sšq)XZŒ U: Z=XÞ&:1 m' lh[x4VƅS8eVڅQB|F+D{dz&O~jvCyw;5RTQT0Bb+_c,wtb-6\J t|{KyB)8ux-&-1ue3 E7Q;2ܪgh0r˴]P/ 42hlP5 TՖ8EYònܣGIz[3Q21?گCEtw̏{Tl2vGhvD .d& Vv]7ѓyViSʼKK+U?LKwke0F@ )@̈́~8b Wd+ a,]m Xc ,{^PC|ʃ`MñǾ/OQT EŶ@]Ri/"d6>8fTـ&EUmsl* @w\H U"HvѤOCj4H$Ӝuh#H]=p K9-hy8&@TsY7Y-Nx0#-rnˑPdW^*13dxil42c544XPoOo5_.:@.{ }v=I3騦.<<$Im+/ѵR /mz ٽp3%ă]bP=ߟ?C:=T)ɝe7W$DX ]| 9Ⱥ[p!ކnu*="0"1DvNdvn#bؗPIJ.K ԚCf4(_hfݠ&"`Y\4# @E#Uv#)`#d:Q"K7pןo?XJ1tiCwSPQ.`#Lݙ#pYJp aU٦yR='h@a 8WؚrJ_k_|}s * -MJv]0֣@Pc%2Z"3H mk'O~qxLޓH3#%e~QLugBJ q9dVtc1KKBETes ]ugm%^Cmp<w`wMä#HNܫ;gٽ|ǺOs&)8;m,R@BܺRsDӇkdBh 8s_hknvXl[9h&7,2hCɂhhkdIuϥZ(s S\ l跈I㈌>Q1i+ƂAU=ywgRHYHbu= 'KX@R`7Hq}!ݥu`lu?)@-?%1ZU^cE&R {Rөg!l <{]1,dUR3Rۧ1H5M옟'5:zg[59`w[f:HUZ]ri0DDܠ-;KbV1>ZjgoS7Ěp45õWE#߸> :'~`^Ay^|hlO1PvC16 &H98T(j HZ{3: 6!NWBՏ̭(Xd"﮿j$^ztп}5`@#LJd=R7OkŪ%\r^G-`p,HtD.ۃ͍Yl?!!6 C g9 ?a}:ϝeU^QvΟ5ȝUT:~N2 +я7 `$FYTL rg.9UFרD-{<'S7i4 8tD7uLVfV-@߾Òs6MU0wr,w`xq_"_$ŏס?W'U*s JV!Х`9FG ʪYVOJ5[E~c+]T8@{&Rz T]ئ)0=+>w!FA<nGՂh594(6"; # J;pU(g**9&o8} *!B/Ȃ v}ʰsg&Pj:0;*P-T:!bHY9 HpHRJS-8 C4>„Z {F !-(=şBAkoJY0/ƁDHF2ۘ[_lJT!B6Zf)= U;J.cxCE e kb̡L {;NbG^RqSBݘ]-jB5c%W9~7-;}oVa!=t֯,ORXVkz/%!m7jԭ".{BԠYx"x9^6q+'T.~ۄ]L𼺗FOH6~!v)TqN$3B~zmU6Ʊ7Ϳe \Ec_ۋ.yF"Յp#k-Z䪼*dM BavJNlB]7, Ok8=$Ǽr6'_kY/ h MlD{h3d1]ʮjG`qh3;]eͨ*-?9m`TnealB"R)p3ZC&DE ;ns)~;6"$ /vHX6ˬ >tV͉dmVW\8!!n@ލ~Ta!1WVj7 !fZʯl y6}3prn%fuA;y4ob%A-s s}uܡ](&t^&ը:@/<<@[u^5@JGh 8 8v|o/KA--a6~k VH/ ܹ QNg[^nr/%du^g&gM讹uF[j8 (] ڧvtK>^!Z-&YZ9ێf7nn6;#zQ+2Dp}-澱$OQ]`h8W"86`3V1YjϨ[{O_Jh"88)˪2 }QHl+l*yP=T#{9R8/@J/X:uIE'-4UyO} sV:,g[cvSVyh#;/"~ ec45ek>(sUNA4(&?yبL9l{qʤ&V*h'F t$swup>dkKꑿ Ӳiv(45{xf ؽDmdks  ˄ m`ZAjN}[k]vԠ_3:}7 *3CEwٷm#ݏb̂J^ kj|TG|sH' Ee 8B KOZ5fPy)gLmsN?ÚjwhpmLK*,QޔmpuQa L};{Vݻ6|'v^zq`%fv44v-&]((΀b_h!5RLrW+(2ۄIm c>/3P1cz)Eο!jӼW<&*e:iϽ}>oF߾ޮL}#Y#ă|U˙EPB }& <}FE~3F^!EY;BC4R7H\* oCIr`>Q>78S$vCt?P^?jm2E~̉PIcVn۠\WfxN]/uvcD8FUs:ΕHRmTl31R>.Տ|@]eA{ѐ t-u)da6$3z"`f}^ Q51$P0WuC)gjg(]z0 >%4rhۢ #bכ9XfyAB3LmПeL:ywhaU+ 2w:d;8~ \Oqd"ܴ`GY{uX,e>]ylsHurs>[GP< B9ldm tb\DE nHT.ZK̍DtYuˑrs'Bvh2AE<$}T}tž aJ{𺎊=hqH^9w )OUH_fcW@eY |`[€)?q //M/&D({K|Slvguci] 8-U=V#1"\7}7`hR%).%DGWRr dnlZ8J;ՈULzhK(v<`$<g M@?Zlۖ&Y䃙z?SLl ]zFj3_B:W-HSgLZsGxhT~_pү 84v }~<gY,\ u$3DFA4>ZmLO8o|!KƱ,At u 6k>gnÍ jr K 䚤&m!mhCok"*䍍1^¥/R7{DؖhL:*[9B_3M:\8翈nsF4|s50 ˢ,8Sǝ wat- ?耍"sn@[N䁩:s0ΓUܻl'(@N#YDM5 U T%$Mq^|YtT^4d!FتG[+dZ%@:lξRc/Eבhz+nV(jyֽKͥXd@,\9)艕ٔg[^?鐩l o/s҇dWeP ҨѴO$,B*D,>SͷmW ꃜ.jCGQ-R|{[hob< hfTcv PMgʹ|t;[LmxE]V1U@<+t?hHp4T&EGG< :?^ $Y~lmPpԵb!5'?:Z)Lt yOm4DH1zߝwclnL]w;ХK&v)KezvƧi9FI:9rBEg.XPF ǟ-i޼mAѨej1./(TN [#I 9':m z֓ڑؖ _H%2{!gt ~j/<- "ȫjB X+2-*Ԏn pޣk7I ϠQ/z!*ViؓScf17bHFah>˔ :!-6͍VvQb0O:bU޺Łp(YDY!9Ն`P-(~3wS_ Te@>)>@Þ~goG;ӭ0a)KyxOh3 jS`FlNY0ɫRK2@sf}fﺴhϊ|z!>%_yg[lX]?gBx{_![̽өNѠr39k1 WK;#|]DϕV[ΏђH[.Q W ܝ9[|oL;M uo!l2ZG86qI5_xHr} Su!9~XnȺj)u!:҄xdvu8`8B}_ʁmEo9uQ}t&+Ϯ3ڃ3LQ6wƉؗ0qgG7xhr1ƙӤe&Rynќd#XXZ%3yQnsDʙڑ7z2ŇIY~{ BK)%/GT"~?qnDqdSWś,X=@h f˚ mp@n8.IPյFFc7 i3WؘP >)b 0KkD F{dD4y YiƑS*/6{>l|RfEL@YmwNdҦ+"5' J+!SPݮ3~tBH y$veMܼZ6*Fe|&a@zfs=π%/ &:W `$s_rYi*羷 UR[)N}_cmtw $/@$fXi^p;i =B- jr UWr/]f]Gbc}Dq av#U 8Y&+}";ߴ#Gs6! :~|;/Y Cyl?$.N> ,ȆSH5…P%T{LźL;vP ;ʖuI<@jL-cIRz$ȯmL&HM֚hR1J(o3:U7|M/uM;m<4o}s &ޗهL&3 놬5Jo|_sKequؘgL>@wU EY*ᇐuOHjf)a% @_(VLC֬.?5^=Vzgl< ) cdL }n~}/˩ syǸ.iXYz ߺMF V#$/G~R<b|xQ=UjSaCwQ+ԗ!'A-̧:S$"-Уsϳ1=^4wDԬ`1$Y=fKz^uk1LA2ɉc4B;q-Zy ΀V8]=db`.CsEZ#;OUy8 VQ"GB,r6@bg$6"7%i>%B~SfZ9np${#ՋU7EmfB1̵J1.=,nSGǦ0ֆ_ўD:a^QrjJ_!ġ>WVXNϖa{7L*-H(cB,`r+E5T ^.yvl֪\x!m9q.,;#(01qR~r@!iMBnG:&t<㻎j.5>WN^PTVe*r&TqNjK8A #5gkyJ6F _( mQ{*r%E) qN:|(XPga$lU3{Gn pd9>#o!ܥ̦!9޸,TOe2H q=uh0? 7}ub;o: 8Ɣ5~DEpI@Ӱ)45;[J[&/pFj9}џT?j.1c|6mG>Wük Պ#4x'"^ 9jYM?VZ\%47)#g5vk]H!xS=\#"P -ь-jV{Ry3Yբ%M\-aEդ%KeGP5- _7O A؈t6lLcՊv^BE#ǻW搓yt{:& r*OQOǞs#Nvt{hN5n| ;%l):=e↤cdR*@H 14o܊>pʛqZsdmS%)ڔpg -勧gH\YL3<+ɍiTkmx[X q?{P[Zh:jY_F$E~A*D*F~x&@Pi0V Ud} ϖ~\S m\~jے:`wOSqHxP44"gZ+yW?/eZHh/K@Jiq˥ګa BUZ3T`(7Iϗ.>4\K/j`pxnxWS[݀ ɇPl4P*\%n!-/͚cA70G*jyw$$cA$ yE)]~M03MZ }I8ʘ+#ZzMƊ蟅&lĐEAjwQ\KGPȊOX ` ]67CXkPZ8+R;.4Qha (S&_ɖW6zC% UȶmH 87g%XPH3`W\ˡZETœu\[ ykHz`?AcvL!P- 'E<"e!egNb"?}v xYj<ֺCgUB۩a([q, K`2^2ßMȃ D'nzS0ŚFFᔤ[#yAkB wm6BvNadnǡI4Cg w?1o,Owr K//,NhBpϫQg& 'h;1]5?JGuKd㜍kxp~[ Zh̒?ɀ5BxiN<_u P,Rq( @N53nǁ'=/6T{zHèCN`w':/<$oT16J.:_8@JZwdLb%rgQnB/biUg뺇DEzơ>)&;o9*p-r?4)>PpJNyC֣My`Jl^|!iu]ze/^ Gq>{Pܦ^ Оqy3E4-#vN9 <"'/ZA[m!jpV-i c' N DTq-V, UZ2fuʋ$0r'7Pfc~Bًd#6:=hh\)gIR647$s4C) cHθC'lfq9ro bW_G߃v-bɢO^q%, \o(e_V17ۛ N3 0n*f]/nEo*l)ηj9"5$2@o\D*rE*E> х&D ]X@R |SɄzYYekuTS,Tw|S$YBMg_t,=,08ԌͩnFد掼M m3 JQ # TwلI!S#Qdn&.TҮ&kn)oI%sbQ?3{Yvmknn'VҔlVzoWV C {1$I k+;%xI#U|G!I2֕V%**-Q>"&bp m\7e=B;6@(q>_#"Vj $EVF-6g46(*c3976_8J*OK4nRLZ9eZW\" rVr5ܲu,_:9dJvUHKYftXN/P[XViK\G?٘5jZC 3 F4& [B׎)ݏ)(GE'|NzGPpRA*6"$'NHl !w?} WI;Ù1圷d$F_etïujEզktV]_k0N (Ew?cP+9__Լ@' .$۵Nݺ;$&C>~IYyy! ֣ 7;ѹ+Y`G`w[8O\Wۍ>](їq4- ّ"q@_jDVaRx nNF78 ᧉkK,$$3o+p{tⷚct/Y~HQJzۙ%,ublBK[%f8ȞXN&.k줒F5baǯ^guba '%L~21Im|8b6@ƆxM:BDFw=ZEܐխ8?$[#7C0X^1ف Zt4Yvf`y')֥RBg#@/$`U-]d޼s, .8H&@QY~٘+>le>Q?1;9ܺrP ĵG X()v6^'Mt-]%Z(8FAK_ypv0i`sD v4YXLzl|9g >VPMhbU4:%\6<^ >g 9XQoA⟏3H4C*w_oPӹ|*=#B/Xqaۧ8`biϩuCG p*VatyCD' ȼZ l ցtrZA[ NHk6>J@Tl"*'dXm_r!҂c~011Q{ /qEԸGl{2hu :TC|bxPnZ'é* GH/MA٠ jg:0VcWRO|xcMNa$H /kb: R Q* m-`K;W.>Nݔ>q)qFi^tБr8ؓa@^)\Xܾvg~CTqb~?}$j ]JNqGBځZɳA^d厳PH_`)QRJ$y[} (ݻO\\'\ $|ME,jX,QvkQ10'xP#l{/_Лڌ`/^z9'ʵ>C ֮ -Lj+ ެr؀!B&/_y#7gr±0(4LOpHHHMѝN Jv@IƍW$ ܟ[$E"V&Gw3c !cAi/UMrB{VP􄮚6)ćˆkǸ*Pм _U T'JȈxN.q7{+2\xFBWX6TYi~!-MMMOQo(HQP 'l*ό;ˮsТdDjV_yap9n1c#MLt[j0KPܨ6fS`BhkTH'6PƐ}]t- a\[I-3>kS;# (k\ KZ{CU.5bY6hU™7)> \)ߵ{}W& E(E!ToMw{,a1#;` p^EIN,.ɼ1*ʩVᶈBuĪIeG#ͬwe\T1uBQ2jE@ZHN"3N>҈+⤜NDAi0*HIJ[(kK fSu<@Vɣn`jvO bPna# e@ҖՃ.h/1ދ?GV`Q@2 {qB? _z%  *C>%_8s+= *Lp<9)wՉ %fj'T iq ^[Xx+!rԹ)Fz+K]0uϺ MadȟC=zn~َ,CG1'ʀcI5QQ#%-^j4 W. F&?Kt4pB4$HDWFDZc<ʼndS̅$X0Ea쥸8!D-q)B`'[,Z0=d'JbPkc6k٦8 /UJ^=9L&`zgۛjO4À0cb 壡8{A]x$[]mrOٽt@j||Wd!KBuFv&f Θ,9W&_gcd)F/D%9W,.oilZ\h4\)R B)ߣxZ*g[(zߢ N/*{gY=_(&a; Lߢx]]I$b>l&\j^(ӉVEE5 G2*k=BPX Oެh:l],鮚UJCGSA.c̺]vbgTi;?b siQM Q~>**3#GsAP<0`SZ<zuJ=Kl0?*?pZGl?#/#~9--f, C~ֈ lhotp_)ߣ+UNWڢظ| \Q"7T->' 7O{YL%3?DKS#]d_3fF(uBZ&l9i? 5f!5!Tf@>-6zBjx+J,t ֆ9"|UXQS U>j#xd‘?>Zؼvp;\,P]EG`:bN~JQC+~b/<1w4O"bNNw·m FFD:J%fE@Ll`4bN`vQĿ]c=[I2k"9жEZ_r5\a8Te+g+}8r:aYպ =;i?ॲ.t so%!YKk<{gLm-aC\]dGTT9vnGOA{ε->n7;YID Ԙ9_b02 D*Ե^'T.Up \nJ 6#hM}{z@pCAz[Q h)-;fþE!} ?,I].3L)pTw?hɆ*έ 7 2!@J{1sN~-8ūݏ>(PHm_"*Tü몹 }_3ٵK<0d$P!kz /5l%[28ts Rd4>N{A*zw|ÔfߕV;e7roBXW6Yh(), 4\%~')`x@'+RGm4#wc̛sN# $g8%ؕf`v*nc~OO)z3rvP3FE^Q}\in\)0R ,.~GdU3'V筸wˠD&gNs{tiݕ62Xnx-4(B.y݄yk9p;}{~-|$aD̻&A,  N[_q=lS ^]a-:)maA ^YZeR0k+Tw ASy&F? o h6Ъ2ogI']{8bmdžY{+#|p8􏖛it_)$pMj,xS9Blcb/ BO>=Ɛ&YqҞ͡_ :yԻ)óʑ139})GdAxˠxGJ7lѱ񬝠*-ɣޔ-oD7/뼃dO\,3`Z&Xgek'6˛`=82Z6G>@nkIFNԕt=ٮlJuY0ۨ102p# 4hh;b Cm܅xdu*uѫРh~p{IT]g*s3{0׹f . 6EV ꙠAasQȠla?6|P Fn^/+p{/\DN2ޏKogQ5'ԏ /S'kbpx8'.>AZ,6ح|H5Ы!|ǎ w;xC1GߣE+Dz5Mt>ݛU_+u{rY`~ͻHi%WgL͟[&>fKIwI,d|ZϺv?sk6SJӷrr];;E1da}YVb^XZy>nH@S@>k+S)뉥şQ)EB?( |q?R1ZWF@~#S}d+PQ5!GvnZ\$ٺhNl%؟׮ZctyaAN.z9bh| |=:EʒF'\TiDZI6;͡eth`%Ai Rk"#\] Gux |¹G\H$?s=>WMf2I Cy)[=sHzS5 ^7]%uᆉ"T*S[%-pABA7t""RP'ʞkw)zT, M,Y?,*6{{}rPIńxͰq嚫 ڮ$UGH3Ō ?1r7 /ɔӎ$ j򘔱k2r|=~u?QR'c9[ 'h~[8yYQZ[345bqϞm z??P+_8S*1o0]"SGE4%QAIge7 HZsjs!yul%lp/OArDLQ Ұ_8ؓ?i8Ӣ3F]Jjdhg7&dz0edYda`u`';;(inRj:hc۳ִ\eNEG>klxaOdۋ@OnZP9<#WJuť H).Y\_ɻB!an<LS;Q^VKMsئFcp:LkwΑ~:ߟu]7}KXr-p-F[C{\]h ΒTq<():}qlO@v4nuw҂Ĭ-A+/(m;vQXm+Gٓ?M JhEj0I4&(R Rw3mu.,x|EuŤ5/ T..Z8nŀbRºϨ\e0$߯$A.yV@@پ0] `s41[;q 7̨b;lacHg&HptzSHSylLjvțkaw&gEY\ezJ`Jn9ԨGVen@n~q,j(N7gfGƖӓg~,T&@^jvZy3+ Hd8NZll8*_qV]}'1/WR +QiIOav)*9Yg:F1Ds$ I2PU tuu`j$,'fL О`LPE*Z "%mM#9 Yu V'uAh&1y] ϲ&Wl˲tgT˚)Y_ͨMM( N֫s8Z䴴q7-b穇j?PnV89!%ފI>H#PU mYEɊ2wӘdMPmۘ8iV)Dν'ʊf霔1mv) w{ELoR ݉ڴ}bvk bfbR-aIg<$pYyWsf-XY?e":-涰 o0 r q"4kj "Q$icB?D"ŖƳWŬy{.P8QM;Qro_ޞ&r{&T֐%gQc/9j/;םgXveu),C}߈K]@_֪oON/ULMnI:m=ar#vP,Gioy)G"]; Pw[m^V iu"n`Q+7C<$ ϴ\RnR",DgڣWs]x}2w>,s+ {X:avDЛS~=G%H(6YUKn$;iq rn"h 2bPзOi3u @u .4ѫD"MQRL:\mx0t|+.L6An@+l8ٓĀOwqAtx,url'}zhDIZ(~Z+<he , k1ܖrbc9EFqyCcN}*vUIae&#iF3 *luZxvto^ (vLn#!{tnc݁q2/\_.V2FuRDDyNQ>(n^pkWPm}Z(WO#p kjx,hl k<ֻ+}y%mhm9 PDB@] |Ƞl9R/[Xbo. >khJK`ko#[?t#~E;OY)d6[;n]BaR&wc=:G޽"D9[>3t &!XaI{rhL`w/`dBWl=X+:VLk)\~>U2U}gJü8p,T1ߦH Sm08 NㆃEM ӊW/;%@ 2m@%6& ^=e8H%t5LHʡsHTM{{Z{(BH98 /D¤3 o#r`MϛWAznd 蓥 l2i٧|6- #UsoWҰ$ {V#ZQ~~7|ZѴ';^9D}[7O~c.\96@GR4pofCmgB琁ڠ!'RS?TFvdh)>6Z^<4zkU|7=1ADb,1OVhveF$QNwmb1ΔHʭAɮwL2Q>:߇ןaQqЪRN_fPaJ?'EV#-7K:E1ÉZ5Y^up<ݩOQ?@k5ZZ)_OX7H%/5d`u$lcC'![쌪mҥ/rY: ;Qb<Ժ&LC.o 'lC8c-w9Y;y0sQ\4i mQd@X+?KkkyUAo*Xw(GCTe3O@b6NȪ-کz|.ſ|Dmr?tRmitad1)'U-'+@Qx)oA}/w@,Lj9r^<:3ez>dht.̣_ 2$G]8kSly\Ф|]f 鄕PXs0Z\`X~-"{i RɪVgQЍY lzY4QJ0zvϣʖ-0tfuu|x._|'bn~|y=!(q$+c%D[uؽ}8ka"CKeӌ| 4Fr8yTjGzjZ 'yv8" 192 U^'gn^Bul35 +.x;,Or,\y*8 Ά\.oZ~0ޕ#|A=Jp(A9'y#HcHq(P OmB(4óo\> ma-g,LMdCP *N*Ƽ*@Z*sN 8 -yԭ綔)J6PfhhwmNRF8qWxv**MmKI(3AthpsK R|%~ˠݫDwMH9gHޢΥ|V6m,5pa-0ka[*uS6?MxX))U+Ǟqe񒁙YPtm5'٢K7.lO,#^uq hm hs|_+GZ$4A "EXMeK$i; -wԠ%Lur?tDhL?2">0cFb2FCudK) ᧧ ½7ӷCVW۱ګ _{gYX6և5Iw2Њ|7w|g"8~'112T³ERU,IVlar;9LȰ*k7AciqK\ K{G׶]81Z~nY%Z@bI0?OG;boEл+Ck*à0 shr&ĩ,C/Z8{PAߠ4H[\K~XRK6E2]=wv.;2< (h|E} QT`ـ&r&`|qYu0%ˤ.z8{Tl9B'!l 8t;ȱ!1lHJ;P )ށa?qjr8~^_Ne'x;Ql .?,} A"ﯿ -me 6XχGQ( as?KNB8Kې='jiWuQ9ݸ U Rm-8-dֳ#Ef $j,ãI{jb-̗DW}y ОsL OZ^@ι&;f:r0Wmwu/U8Z-/_}T5o48iH0;Uٯ[-@'v(YԨ-w{cut Hpie~ii=,Z<[7N")[ Q0 YnZK&&KZ= DV;]2Np3E5$S.\F|\Vŕ}&ܸE[*R֔&KL囏ܖ{( #5n,Pߵ<wN:/5{Şٟ$jr{=#G!%n0&9:W]LmZ8g.:w0!G nw:ÈQ#t z3c٣T;%{4RQSi o[i3C{ͤvGדju_[nIy[rbEnK^SwGjK'jQ@ǎ9,AXk"в6IiGzk)SN_S(ٓY E}C9u.EYXo-A er]6wVy+O7vTndJX6D|zvh2cC>pQwgHps Ux0[s +(+@q/7Al1z[fC|g Ix:}ԪN͉W74 =#B,)[}+ (~WO-)~hᏴ,,D 1]- E،g#;Z2THÈkYqs (t7zRީSɧIzbo}oht|P0i7H ϸH-֛|~jӿ׊3zaSWhrO/>kQ pŘ98$x[ S|:?o=9g_%4Ȯ*Vr߀)T''P ޹ea@d_ /AEOaEiH+MړCEgQD[m8|RIiZ";YwÕu(pPkgFCHU:{qzB& 4?H^j?Zqp(0}c1RGl,}ŷ+$T2TZ{# DV2-# OqǫO">'NYbḴ=YgޤUR)veXfnҩFl~F?L_pH9I9>a11h \ T {iݪ<*!/vxFw}TT'h]~~Hx^ADTء>dI ;(/"GrƱPcNJEJ;_DVV,eO޸7;ت ^0%/״s:_vr/t]h+a(mV ~} `ƨ' !е?_+c.,ՇpBK,]/ zܴUh1 PEMLOQj.uי k_~ك~_@"ץgu#V&2Xgyh,1>_۬w~OwO110 z48z:k[I4)OLNuhЍ"VN> ӀBdpl8=i+I "Q+ZKA--w F4#0n% TS t/m$aqCn*8'.VF*"AgGHVRR3a1/\)& 9o@=IS8!?';1kEGףv5ܖXW*9,${TLt,p1p&d"*խB|ҴDwRZ3aiI[*s񓅐}N"Jͼ䱓xoup{"B/F{tD0Yʈa|AM%u] IЕsxHRhݣt0ov7bLU/SD qh{B,bYib@5^Fܠp]V;A9Db61'^/W>:Jh!~JCEBni@^td!$RHzt秇͡4yZ {N=ֱnSw4 <Ε'syX?9dըkEL @_C`l݄$krHW`P]U\֏Cz0U^c~&X6؉)m3pEhHgi}=X`N-`$\NYCB_q[h7rRAx-NWE&7i!z 8PG*k,!*oK)9YHAi=(EF@I*Cә!ϊUD56'^u[UĿ~Mv%}gPŴp8Z+89w 5֍"BbZ'twRxx6ŠΞRr\e(T,Q̣,jtea9-"7'xlGn*>6xQy.0ˠ=U!!KZqm?VyI?B_\D"anOgM pEFAplr(+/GGyVJ?cíR$$zZX)c}} LY,sc*rqBI_kTMP[l`$b@i[TDdN mHS=!ZJF74qma2C_ 145$s7Y%/~/5!h@Qt; t21~dՇDZxwTy0PhI<c8=D@K ,KDI٠o$04(!Xҏܑb@4:dx^u?- zV*C쵂 4={35EQ:X#kS 1ֵ{GCCDVʇlȡW 8Q6v0S!aol(1(^uzZΊfz!8>$k] gҥ5t :Db[_+]*!!pBL~ʈ#`ߚDrZ4ZR+gr cɞIQ MMeDCrT.f E aI2vvA{㬍PvE?u{?ܼ}"IޱrGƪWp5i] sެ6oc(T3GJ` fc9g9ŃrWgzlkY1,3P|پ_& hwu??'"qG_MpĐ_ !pZ87"+ز߼ɺMƢƚǩ񖢹@ɬ{ ojm2 >j&4+e>JfghǩGMHmca{-6!^A{4w{ZۋFaRX<"ßcff~ۨrrg oK7@eJ#9Ua_JÝV뮀i5`Q=:jNC\cX+V_U嚤)ԇX*BϚ'G$: 6nEZ7}1/{\V>kHKN{e|ďf 'زsċ-ŀ2w4ҧ|׶:(L26D4b2&תcHN2d%%ъ:ٝ=j#8jeBT/SKz `/, cGk.5.Z{I>ӺCw!ư[ZSfIpk:&_uFU沓@<.zQWa CK A9,}h?9{`龌 Tۂ6QZ<7A:%A#n1,3ЛO1:Nd\Ů~^\̤/s>܇kgK4t4yJGb# yyKv$+ V5Sz{uȜ6. 3;V" %*#d1r39vמ!mjYYMCc- 3ϝ }Ly+"AXrQV0Kyݠ#yH N6SL>avC8|q)dVܖ<.U牗$d|p`Nc܄JsaƼP j$,?S3%r,Ac`M,L߇^mcE:$yoxQ[;Q_v=̱G^hF4$ek=$䓯y :z]eU]Z8@2k$Zy[4 Y}XV t9r7"Z: O7o34" 5pb3gxYH3km :?RQspX#gܷފ21(QeO[ȣy`?njɇhQ $ϷEA+M wLtG l WV4.>k۴5o,ߦ`hoO9r^!g=ؠy/ hibvflɰFl \%jƺdY1f.U xWUPud4zws&c%?j1R_ݶԘsFCmC~#":T]*>Aey:J9lϑnnhdEm5q3"yJz#q(c1xKh4ېņ(Q V*V&:4IಪJB;C俈2M8j/K:{٧W?M!,,0hLC$[G$|`*fFnVLgW1[SbL:Urێ_× ["2:쁒@Z78d2%L, < O9B`5[EȌ?=AhYYӺN+^.$gë%1 0x6r.x|wV]༞vR_}Y69$a;hjqߡzX˨ʘڰD# ?OOnE:RBTo#ʣ k6[N[7]C{죡bET2Ԇ۟=EQ1 9NMWdKYȮ~N=~]Y?I9vi6y΋*9Py͍fJeI, H6KR1DH Y>LS`߫Ź<%]'7&;L/bs5sAbTk[P9rP@BxΣL b/Q ܏羅+Δ)V뗿wfUF`AަBYX.Z9:UlK!<->ōAf܇&p,җۡˤ:껠jS,):SfQvaSfvnJrߎ@k@3Qkp㷸sÁ~FQy:n2rtC|vQkhfQB5EtV T 2RdcިHmn YD g {^ax^M Iы"q8_^TA!@T~߂Koف;?ӡ*>.ݢ9@YsbF\B)hHܼ۽ ~9$MXӜ$?HN?ܟ]/y" UcVfCq׍];I5 !%~?=M7:+vx9T&Ubvi?ouYQ/ {KfvӇB 4 V/ό1Xbu 4Vwi3zIZ⹍ ڟ NHi+6$(GxD`<ԃضms%NY[MGN@'h@ʑ6cgo+y?W.UxRGf)!bm'z&[˲)@ծ 'xI>{E 6J!*}هaA' )7]iEw͕?V:6FMgI$/<^@+Mrb֥=czI]#~I=/ x€=^րUPT$T_,Ͱ+i]rh{0Vw3K.\wf) _Nf?T/S-l&$gZwodȞ'1dP$ hPW );S( g,b@.09]q Hd|sY4!ԴAR=E`܂ >.u/lֱ( Ѓ!T]&S # |p.NCl0\{-}zlיCTH4`N.W÷F{3u߹쁎po_XNs Q*-&B]'r@C.Ɗ0,U}BfٔvE7Y#8!ܱ̊)$|9Q&˳m5XE(g]OH: TV #6]gFkOS.֜r8SBNX'^{`8wFƦv7ea&:499 b\u-Fa} Ï%׾7ШV XP",m ]wNњ|XlŌ6g*~[cAR}b *"P$~^R2 OC1Tk|)ǎZ+JIBx}O j 5xTEٙ%AP8P|~B kcM;Qb`(Me_8{87;rlXmIx/TcxN\'%#Y?S3J=6^wrvWԲ7͡_CKw3KݠnE ?p~6H^Y'D3H_7:k =r>ce7x|IDrɤ̄Std6PCQ-%ȼ)ڑȕJ2_sh X2MC 6Y䱣,9ӕYq.ʆXhǁe&ѩ|^s`*L蜁R6.(of=t߼bݪ9?RO9;C^BF@4bda\*~ǦV0?H,@<8Z%;\b"k<q5A;Ԫ򐫥p4wk|>S!sx^\AZڀm*#LJ8 CQHϵGFm;~/j j=ygrJ3܋+dR ..I3lU{͝zƩPģ l^j5 c?C/b`SZuD"WEV%Pˎ豻սf%WͺOI3F5 r42-쩕G lV?/s?8vTϳѳ(7*opd3K+0-u{\Q/d/zJd<[9'Nf#:@K~FzG-cN' >)u*`%M^L+6c΄z HH(6+GP, ؠ 4P lSoj:L2_  o+, (8ןsrp84|~z{_g:)!Ĺjz r26Q D).ҬClP5a9o|,LܱIo 4etR qLA{~s" ˙1mFGSN`Q-_Y\1h,nGwx [i sä#KN΃~pӰ]̿f:l1\R$ z_ Z7=E`CzN]]>ar0vu-,W$i"mr09+!0 "ȗze8ԓhIS-d VRvr38 -#q2֝s4FeqT>#wdG3acgVu`^V~&I.]ZzIaaztHN'KD]Kmv8-v8cEI)h}'Ll:unJmlBpQ\HEB Qo|m˙t<⇩HD0HI_,q QU8,}5nMmac:?K9N%dCb_fEȋ%-S"daRwB>%>̲@g$) &ʄ,PjmGWa HB)~jeT?r`{“GsiPQ0+U(fo0:‚]h3bs9AIϷG0 -D6 r}GK\@D3׵3P/'sU]8p8…e&)S@58$"e!@U-Z$@o8v}qHJaBhJ'ư/ i%-SIL/t`%,݈zN޻c wz5(!>K4:҄{qj|ȄrN56=.c"C(ϤC^f{U-e5A ׮ ֪ `˸bsU;598Zxyl,֍ puiR(:3(ꩼwa&ftdN;Z ݽzP.V[ay|޽A>bo˘5@^5f"R-^?֚cfgW%/z@K~jOh 'B' :qr PWɐs2! `#E {ecÑj #|&3|-65ӝ) F4 zKB1ƢL&ƂSfrd(& ϊcqa H*ImͿ5Fwzh!t%#vd]}(-e4I=[V!  {^^R__1ReE2[ޒtw)q=1 OtR E@9 3D6)sIh }B]K)+"m%eL@8rqߛIuJl&Γ[W=dO$:SP#E%'MaKeSN?EazOP\fR7n ӶdPu {ƈam&gkUb땫ipX xի#y=t=-T;ʹ᫚hLW_M*]K% ǞA9#9/; R]p꺠{ͷo6$>ac=#B$%qɲD̂>.'T/=j-:~"1&+?-cpRgV h1s= O7`{v$9OR!Mp%9i6EO45Z`ښN=<P`;4HK+QRM)C :m iZiFjra2Ey@juv $Gd^vvִ6q|1nt5"Nc>tPy I%^HFA=q$yi݇/A涊D[ ZN* gbG4v*G9FBϖ禱bMglM?P_PV5VE 0<#ƩnA1Ė{.??$Iͫd䴢\KLUQLRd\,xߜɼVId$yG3iˌ!_bZ՘֗JK=Jyh=>9NoQ.ʚgQ9.{Jp}EC1e a?_<`@-L1pҿ94R?ꎆ8pѴ"-ܟK3Աw 5Xr gsg2|YfQRAhA؇N)&=9O40i`Ԣx2 )Œn-s4<+;8`|'!\I-oyҍ_3|6D@yS]U4>p 5vSc0b9 %6~X!`N|<[N:]S0k=mx$\eO0WeAXaIajt4aq+W7U"wTyQ)l}SA{1`1EIIh*gl!vկgMvY/:˷I"_WhaQ5_HJa-e685[Ȓ>mq( =]+wev( 9+Sr>ºl4ba=p3P]I;PbV;Ǒd+yc4s5_Dsܙ(`"NэFsP]EwM{0Ի*y7@Efgɩj+R*Ig3t)Pk 5S=}R䕂U` eUVB Fmٱh򔑒9 L/]R9'9a~wkh ؀9:<;geA==zg͕NPbrGª!{)tp|t,  G㮳Rg|IEfIdtLoS|E뗰fZ&95%Tjp[)E⷗>(ZFt:)(4aNe4*j x&GLjGS_4dGD}7#۩h2ϱ+Q}[-Sh:\yELi٢:31Z:Pi|ԫ6 ޫ} Cj@ b[ :8y}s'yiKZJ{E1&T@0JG?qA8l~H]m!`f3Ye/䊨d œڂmoDZ*&Z LG{Ja\Av"2 S6氬ݫpL" bRIp ǥD/mطQ~>yo5rGꐟtܵQ=X)i/hO]w?yő^"bHtQ"4ǎ'T.1Fp7 h zx}MrwPVȋS.gQ~rҤހTLٵX%X}JAo:9`S!,ДoePj2Bϝ F"lM__\}J!Oi)kAEx_2$WV(m-Sʞ"=Blk6h>vм2rw3KS'}ɣaqʵqv%XL lRZd9ExK&0 I4T'y!.T֖ n0qt5a.ڦ7gFV/`R ZZwx(Ĩ flA<_ҰVβ{N0? l;?]fa@l U;Xp#9RӺiTJ0|٫r9%bCw@ wa)Kya^ЎD̦UONŊ"JmIq+~7cZzq]MՐY_ծu~9 ;l~e* Jy;~ vr8L|L)b,;">"ߐ4$ˢv-̺EQCAP3azBV@bwdʿ%h$*|s7ҳj,H?Gzow;%0^B)%,7VXB٨ snRTii?õG X&Nȯ@o_j3rGj`gOF#A jhI~G< VR{Loi#o6mMA3nkum WL=/}ɺrTHKN>Zd r$ = K>yǮrK}_*t\\4HAsh='d⪉X<8ddž] QeRHBKCdvuӹpZ4~d%v%^M!}6M_(Ϸ+ Nc;+Gu[1m!`'sHӐc3lyݕìR[ޡ܀RJ6δ;'Vr"WYo <.qʳ0*uT64"vU\73G`QUB&fR)S/pueNRgZv=Yv~isF$޻%HT}hs)nn!TJ) IIWrbx c~HQp`=9a6 6>)|HW&?cLPz yYyuY~L-*Kb%j^\ZP!y1lUA 'u{ExQDdRUlv7qIly)ƸmSg5jjks* $]1b^n8Fsp˜ &^MԤf;Ht@{<;hq"s]@+<]΁1;DCw yej7 ')$uTDRS27Q;)=D [dKʒ$+"BMQNO:SkMCP;7<9ՔXfs}J#JG 7$r6^ނ7뒌6)덙jʇWmμM&׎xJv~sv5E$Hg6ʄo獿_#h&aveȑfj<5~w6|(\H\T!aA=~XЎ|"^;S~\?9]Y~&{=ӕ&ݬ=a=AΊ d™tKe|`h7` k8C.\>+wG-:x}=N6:ah_9ÅE7 ~&$_a\6%׽ /[uJ#dv; 6PTx8=\'}cWZf:;OH)QOIXzP`>؄d{Mx%+jhn+\ R͐8UO#(IfX~3˺ebiz.QѶl0APVPJ X/18 ˧!YJ$Tƻ%oTF]EO`8+ݠ}.5U بТ،;ID P[EנzLd: uǹ_f`y"(8ɱa͟¾^`-H#(R}Q0l%/jd/|Z܆ g-cX7w,"1cgĜniq<A0iؘۧZӥ,}j" Eͧ~1cNmT #PYƓa!f`i&ȖU99ۈ|+xrA+>Y`&jmY]W}:M K8K>cm z ,y\}[Q N6hp q˒N(MTtݡo" -΋4뀑3xi/̙XI ԯ ©;* m&a Bɏz҆]ɴs>&rؔ8>W4c!BioLbE]Fa^2АĀ=8}}Ʒī,-ʟVg-kApnԪu=A?pZWGS|QvZIڹryhfT4xy߾Bô{wbl#$ nr9 4ey'w\mЫc_#_#4}x]C E/b(ʤFm jؼ1fW#a\(COnp?&8Z,}X[ϪI>UNcg)ۊX>'0 P?#eLD<̶Mfz~+Nm3xn]W9gUXt")a~ :t^Ž3W܄dKڔwhM`Ex-ufQmǀ~f_4 c;.{mA]H.6[34t +3jzNJMecA v Q%KB C ?zԲGޜ M z$O9B6-( ֶ'!A&j.HYӸ]`':DIWl5r\[IM5Fl=)+{5Rf]2e d=S!Sfp8 jd4vA=LY>Moض}WBA /5phFBՠBEjpPό]5JQi}bdi&O|'PF`k| >K$"hǻGqƻ׷P G F-9JrDDa4kݛXēmp<;ou9y4IɤVᅈfĬZ DG<@'í6f^Q@4/1?9`DFU_! _u0&_" }DTȴnPdϞtBYȽ1R犳lOET֦[3*.tr+9jVE yF?kk9Δ*Ƌ LL^~WteM\q-.#cqFNS׼#՘/tQ^㿺-n j jK jq = Bvrm:]uN(jP:%`O]`jtfqW_qGߣNG矨n%c5_ͳpnV7CBv _%\zu))\ D=PhpPI_IkH8{%:3ҳ3g߲9E)33'JA! SRY8E$vC;IZ=B֊j 鹋WAt#/J -YѼe5F-N#(K5p*[E 6 CBNvE wbq8\q,l%:0t\`grlpU3H-4؇P)5 HuڂOLhgr z0l=!0 $抪(I >hc7{$p>p/mgw"C24f7+GJj\ xN9tu"HX271`{#v@> 7c=a8Cb"ɿ؅!jYPTྚˇW|{}<5_Z*Uv͙W7G0x9C6/K eW=ቪT2JZ_:@V>QY]4VOl qmnс܋ 1WZ[^Mbes5j ,${/(.`stIWzPԕ[Pytn=S9o(;cEi;HɣK^H͟(;w$ ({ KϢ]ԟ:,c5t(ﮟ6ttWP;n3RyV۔n'gpXӮ陸KCxHc?`+պi)wbAbУ;/uRM-1p ۠M*{,3WuU,ecuЅ嬨..A,@^bIJC3wR(Pq(Z]fb(jy .М^vM &8g%>r0lqVL1k}ƋpnEy-Fu䭸Y-׹ok_PX^3Tk3 wKsГרn@Uc+}bbv]g*ДC50_4ga$(ԡ>J@ޙߖkj^8l1KZvL7QklHV7<>ab ] kU~ן)4޺ܞ68STsXBwB(͊իpb"Z|R}dMEHRe )]p㻜"@05)@YN M>Xc+p'84:gDS㐦]%D1֣ǹG*Tu,6 3[hQ߻"zW, R&6QUבigxADɮ|U`^;1<ΕYv>UյK7XD3uF("ˬ)Mex_{pr^oD|pm6mRl\hGKD'@!„'egcVBm]N}$6V1|%ӀKpi󲂅HA^:b&kmï|LY ]u8S T##t"KRtF< *\z-!_WmY<ڹ3.N7͌j"51x 8sEtEye»<7!|W Rz|o x?ظ-LKZu!7ޔjSb9 ~cy#!M?q3dDN& ,mu=lnUMbx1WK83)ݑ )T[Q_=*0s Mn:[)JDj&k\Gg+MN2ϣuϕpiyv3nHP=Ex8xE-ܘPyh8ނΟ+aҾm'R faf?BOa5;퐩55Z`ŀ1=ddėG[ b- xsyO⤃ YY&jHXH|1W cnOp&}ܨ; "^05񳧤=؝S6Ɲ߫կ5;~uY$E&@X+v|X ,47^q_Һ쑲 t O[I=[W$BAE' Hc-vrieT82|y!\̞xd9 2hϴfʸ*wlTj_IrcTq:)ok{[!ۗjr׃T{.&\s!짎v7q5m6>+:hI*zL<&^U7惁u.)ឲ{E%͖5eNӏ皫*/BeV]$F089ғ&Sw9p_H8ШlbE!oH5(.Qa1EyeMh!Jm)\ ;ْ"`Pk/o"gJ-݃GBfE'mQۨA|^!l-e'Ĺg OmvuŎk1y@tf |99᠟bQ~4.<]ܯpӫ/ ɬ4W3Ya^0"dMVvFy{pI' _q-iNɝEn,VMDF"ܡ-PN&'= l;``Q0i _a FWD~dq%+p9rxߣDwu0!|X] Gsn[#)_Ma=KF\vvIR0Peֆvz,+QgrGAInֳyjLjl,nC RB뵯XF<DӇ?g߾ T8fgݼlx4+ CPб)QLzYOt!i;j"y;^}dpw M!;y΀;U@Q*CͰ]J>=>:d䎤uk9ʨg PaI]_~4^YhZB c$|.%)I)Ky UÅ u`=K=>PL%q㘂c3"4Zqoi+7J\m65j=KuRo7n2w+ 橭L~!4(BPK5Q}[TK GL -Q D1M?iՂk/ܲN8oWkc[zTDc!L 滀{^0 ..|g̯dF>!4}gZ1/]Rʉ{wԥ Kt#lIRQa>WTў•N{nFͅU*^atf_p~4czi2:z<:(lS-RD'L0WBoy%e3Ѭ@l:AFpy̢٦͘4} xTt_0 `o-#s9]V~05in<bS;mP F}@9[@K1BIl]{{otKb{k?ov!JpEZ)p0s65cwՙ֛OKvcE$E6O:v^ڮ5J}Rz+l³ 7[Aж<_eZխF{On?ljeHI7lpŅoGGZJyUE-o΁&DIbҮ<2>>FV2R-3il[t0-g%Fp "+q']HlNSΥKd@$x53FR"fa݁hgiO) /.Qi8(E/kt$J!@-cŻԢ (wm0bŠ veQ@Ӹ/SZ+q\FU8!(t)ǟЍY׷M8ɵe xBX$K9. XA ,Ls~q.l!rEC;t߶|]`['`j e7 FabX<Ƭ<@&*jV>iMZ|CY"=fwR|E7S%*wJz4cQEPV20׃z.Y(D/_'0 [hͱ<_--\!!u=,ªmXzdpF1!fcߩa z@ɖ.yM$'}F^b]}_ J(J%^1z~4pUq#Ft7!$`nл%1_$ F*Dt!9䄀4˥Hɑt͡bY Gk4G25Wfn'm&rex8YDx麚HjpFܺn((&fs}V~[&0y( Ezy@5$6"\rUd&jov!Y7jF&'M #r  xךJ]8L."SqUgFíBz"Ys^Duc}'pw|=]-;EU~te-M_FjE{>}*6c1ㆲC̓3#ߠ^dXCE9Uce3k>|9/xt$mVt {jE.wNZl;?m!pآqԧpف'4_n/h&Kf2P4D;JALIAKN, cF)؀Bd΢Tbt(ZQP'?uwt19"4; 3'nN;<:Yb_hc:ܖ@$)eN6]2(?7?ZUpx\~%(j|o XW\:AI_{,4>ʂIS=3y_Q;麁6:ˬy=#15!+3l>뻱6JF s=Gk ;NdQPp] otU}O3/hOK2;WkLany'&,o+`2xd]E4 -*xnf 4Z֙r[?Hmx2>s5!']2SkV1WG yۯ(vnr[MkC<˻Hr&h^@8dS؉D+{[f X5Z~ĖjG k>{l*Bƕ]_x,xE! v\27{1ЎI- o ZGZvUk$}~^хP2ku%m;B,ڵTk ۴Έi[id7OlO!lMXЕcrc w\šDLyŖe&kJ(C3Hg*xW` 6Ӧ25ívf ]uĻn̎)c.=$n8]xr8ͯbﰿm׏7kɘ5GP|Ec_>G<-sg7w 3c!5eW5_ڌr`d<_%j&cmP JrWLaU O*W n]!^8QB9Iin᧳ \eD֐؏pl$OUIh#h};KYR^̕ß}| K`ضF>9z*5V-^ވ&R-mLz3.Kn,A.y{Tg0FPIᱍ.ϾY;nmDiCu}pZ˷![$%!I]wL!.Sd"@AϸߑsOQc4#f/Y)_ǧnR4,-bb'_5VqNj߳Ȍyơ]Wwi'X8nZDv:SMZ*Jr V|< a٠ gi\ӝ{,alx&ec3 20|֠b͆yU(2G^P8Ļ1o5'9nHٯh|*}ZTsp7D郞T//]'_ ;k6e7S#<rk uCĈo^yV MTqUyX\0#)(.tnDˊ>ww(OHߊ1]^> ~'d/v7p/ ;]>F |A[3F.J ?Ё0JVY(U!!WfdE22*N,dtSW)dbPO65=s%jt"o=h.GiO^D)1'fWt݄,TL[K+:D*`@;sY`Ro-RGCp"CϟOhvb} :Pjmenv~F${Yb`ff^S;L b^rɠ8 OEUnO.4NzR_j 5e  [3)!GL6[#3 \-/ɴN}:AXBh4_|DIbk^]CPoC6gDFDb|,E ֞flfwbIOW.蜚滉-Bk'd]9ؚ_}}3oLbO!0Ha'1~Sku8|!Iy.>#KB_^ @n|56kW~Ar|mj%f2!2vRy4d~pԠ⡈ ( w9j e-gΫ틭uswk?gsV ^/$2pJx{Dȣ>woA,|vfĈl~UƘ\GI{dF(oRPb{)޼#g}~trD;[Cj rl7='es,F .n}(Z}={+;$"y|hdXFK5R}څl5k; ?@ PL ~.JG_^X7[lnSj:KzI$:誳҄=!N/WEl֩>q$7M 4HR^/A^dIudK-f٧Gg7?H0)5lפ]gṓ MܻMsں dn!_)B b/*e,"4F>_S@|++ |"ז&ƭ ƒŴQ\~Xw M#0؀c U"OŏprvcF+/g T#8S#M՞yuifb4C&g|߽u4J߁K^Ddn N 'c7rQf1PXTTnT}z_KU1Yz'dM+4` SfUK|$y1"R{x2[1[y) 9 eU\Vhft2W*e&:fpE{w5j%jR Kaw4T'nP~$gYB|1m ހLǸ7%hRO\J!V$ mݮeR(tZ$o?̡Py2C(Q"t`'K"c0s#ԇkyl$,DוC496w  jkX)ch~K:4e 6$Z`e}k[~8A>aǏw N?7iz* ¾Ho=y~C88o~  CZMP31ԦfGfӄ_AqĞ]y> %Kk S?l߳܄tLnsG@)|:k%KW%3,?0}SO.h''z9h㪑^d qź[E6a3t lmLd[T5WВH7`<E##c^-<1!Gb?+0 _L[υ.U޽m(}i+{E#`Õ~`N!xh[ PJEl}Ʋ-VBrsq#ԑ٫\Ǯx\s^JL:;A'ãOǗ\tbЉ9^ذօǘEVm@htgypT#WєwO :irK1 )"*͆-zXt?R n 8}j2W0Cd* >M0Zy3dAM'HQ-qQy4.'M=R`+:I.&POeX\#%/D&2A-?vn L@&HE'Lfeøs EwwqO{qeeVDΨq&;(V*zXeN1f"WOnbGW*tW>aM걻[I8 7~1`Tʌ k+QoK\w#c4>;z۽ \2+[_'3`MQBi>* [4tZE)in85I`xϽAf^CzfZ:fx":Z&81;Q0MN%z<;u~S$3[.Y+Iv+H +`ĘI:;[B&Mu*iK.Ⱦ)$l&gdHm-k{Bx(ډNqѼ9L[]#KK lO8% yq{⠖yev˓v5`i6K 풔>Uܨ w2MxJmxw7hUDh  T]yYJȽyRzy7 x *rnonݛ'2߶ay"n s"[Ebq3|79^g>$ew$.sa7~ߨ1HŒK}K" ? W@Q NafjҨy], i%,6T+oKh_O6eOYzOhΝ yɣ$Ȭ>$+ 1/wB<6vrmͨ\8 E|kײHT?Bqx&N_V>z$ /yo*ܽ ' ~t26(DZ/Δr|w{ѼsU&0e(#6^nAJ54ۈ?9L-),#;OfW7"]!E2vz|\k6 $8].KܢS9Vzj5.ٙuWpرvA6,Ѥ[3GHEVFyNtGM,cD.ˎ OS56*iL 5Ƿ}/E y074;y奮fdpEh/lnbʐD|+{A˨iKpS1uPL*QfBb9Wؕe11D9 -wH&O?*L rEtCÙňO >,3mBhQ~tXY=o/xˮ1qRרçyWN4:-c  pO|8 DVT zBr$J͖UzE}W9׆lY$Ս& _Τ+Ԩm"O-,1$48O %r/3x% ]:pTq85E_`O1PaDZ!̟zWEVfC>%8jx-Г(b-+$V\TL\ tSYcc(m0fNTT6Б?'$I ( 0:HNX1ː#;\kV^SOֿQS gHO[i"yb: 4]K4_ qFw`(I&k0X˘]eaO(v)n:-j=Z P{L˞;c|Υ/\qt64ҰeeU&&-,RFތ͢)h>hJ KR"&(/ҨBkr ݷx%{O~7|UG+^~IPڍfhYiok?o`F4[ڼ]T]&0,"(-}u[ n7R5MQbHMsicyKL>olcOqdG8k=(2#4'y rh'IG/xE,+W%u#- !~'}ϊ|ra؛#fz Fy$BkݪY lVDKZ|өm[{N}Lg.Bтmq~75`xk|]2fUbW4+JPTܺ#&ۀp+Vn^sT"*YW 6-[h >} lX!$/r:ڪ 簾: 9_:;"E[i,򲯺vR.5z1Nɧj B侗qPx-f%5Wr@UƠw; A S)iвUC hz,SoDtɗTN!PM;D"vgB9IY]ްh(ql\V-ՃO1_ye.^8l>_M5LC{ wR'}Ϙa>Q^8ߙ., Mi# ;%"mZ]vLv%tO4[3~t?A\>1ыg[p7{H]eo߸5Rt6Hi4LṶ)x"9K:N׋ⴡBZ=;_L nTφb; *-K ˛̳RTxX<.$+iPf_^A }M,iG >"4ԴQۿP5kU<9$XTI8՛H!n)FU5j Y5Knٽ/@0YZhJ<%5/X0S$v@:,~'D0s4%T[l04=ƕ=,++XxR;. buIER##Y>[/F~rԡ*X !ٟ#Ԟ{se~hi%q ɎԬ߃ iW Wɉvk,*(h:EEpaWIyU&ѰnU~6,0>9SНl&6l h<61 7,+ _cc%% w=J!֜m`?ڿy. |B"0TQ³^48꺇rQ}|BnW/ѼtEZ 5m.TXm@AqKOBtϢB{ۖ:Js{Kt`d`3zȗKk#+z"&˦&s A2[6\}KrV8ƹc$|&b-#ij%D%wUeLgXCAUNe0}Pd8߭憛u5g5w \>32ECVk {>}ՎwC oL ΰF@] Jx'¸\UٹLִqd@khi\~V ֋ֵ$UAx^.āPIe8#pG{+ʪ1{t}AH=lZaW@HD"aa++aOqp6l`D  Q %sQWVSeVe洇Qog$QB󭪫C&aS7S$[o Lߊ@Ë9,K_)F+Qv$/*3\8ϮWVs`3BLrqA5Orv}ڷp8~bʈ5c1˨g߂gcة󇆢#3R&>IGX"3Mb9e4 +3( Z]*+EHް4|pjD$]#;u?1Nnΰu\B8ny"7QOrń N DYD9.mؾʲ"Id`(RMVb̐0_$[5?o97^f;.%cO1T?Vwzi9W`鯽;:ʈjMakMj:x M:L>g]о`7>F5AKf]־?N>tM9讳{]@ /YUXI$vE:eα7iRϨ2p2nTˎpe~OxL"1I|jE2&FLXX2dS{nPK& P"vPiBFlK\~YB?ZWXkᰌƭg%M3 7hOޠRy]V7ݞ/ OXUFs $)MsǻgZpŸV?L%݅^ӸoF`… }763f|-)IJ',ɽ{!Zrǭ8k@joEt!.u%eex U" >P$A8LD,H i0B!*#ZKf;OΝX9wcEHQ$LW1n2u1k>ME .]$vBtM&aط(l\1B%HE;_ !K0Z΂6gI}0V_‘";vfM팺bҥUJN}|Y3vǷ"֪_A>(@w)pp|p)`]!t()]T^2Qf/-H'Ni:+ؘ6q' 67 iBN~Ns[`=SN"Q!}*v]Vvv,@FcʳDn`Ѳط@oA@(4R]s帨]ۿ9 `&]Z*nI O"6H ~(/e؅t2)* ܫ}]aϙH@g#na0h3:1,S,/#GkS6mS6+ Wޒ&̠Z~h_$%omJjأS:SwN6v~:M5m`U.d|CfOCr9ʹgY4\S E_D\}IveO>M /^N',~ zԎQ;ӧ49kH&*4Y}xLDDy XJ)G LY9Go]fC4|H(6R{M)`rK}A}vShae "utDDIFv*G5*SGe|,O+wA*q\N-+9,FNctS^F1'PyqVuK4Y:?]pAY*ѸAK4V-ΑQ@4R,Iyك}2&tʰ($ݧއռ#e dGaݐ9wCEC(2LUiKB7p*vxz=n>KNF E\+lzܶ6'tѠ$)]GɶS~J%!-ySm\R)U#O@J&zio+C#</:pZMۧ*!vSjr!K+j]>}SfT?m!un am5>%r4?h+m(<C`^-G"^3 $ƥ垘8=!Oy *S IU]&&廘"u̘ W`y{>~쭘V}L@TEI-0jFZhҦӊϿt7ƅ@{醯0`dEcqᣍ(qkzK;>GC9awc~fc Fg ꯿*vľWCrnδs/ǀ,m;(5A{9u=\~@zI #IXȆKǎ߂UXluIZ%>`d$qo]HJ#BgLXYeUGy5"{Lrng֜to! #̝+e(k ؎Cz&w&c!{UeA[f\lGc,3|IA+_+`T _bH|8~mR/)}jŻiWnFYaƒn = AvDP43׺6-.2N_5EF$ NrRҾ&O"bq`\͉Ȍvp5 d͂mh.ڸ>%-X|ceays%K6AuK غkIYiiȢE.^_]IK"#p5cM6#LF)s I\ lnKtXC M =Y|lx]nEIB4϶oʸ z]*7Gro<\7sֱ؄C,khnNon핒(ζ$J[/P~|$3 ?1WZpTSYՙu%6 Sd>Q'ezR[wryL紕~4elJ J#0 ~!~srq\ 5# }%q~{~*=77h\7U†?Gg8G{8\&Hc ǒj*]NhuMh|MSI2YHͿ2RH1jqx)jqFD йw,a^bgOY.r[Jb"N{-JAq!@P@Y_0ip~a#X.3x ! s2s3TVAw4*vXy I^jBmjnj(79/`fx ̫TTe2KvЗ֨Ɉ_5U|BvYd=wwT>}k-/f@5Owyvܬ-K#yg/ws jpo[bjոҁY^~r! d] gv+ͧ`Ui d+7jcb%Pbz/ԹXҊR&f) ͣugrX˜pFSΐk8 u?zv/ \2Qn) z-o*ii0 N7NO9:!B%ňOɾ tkCЭ,]gVLLZDkUrC]rQ Bꅸ&Spl  (uD"s +QCsx ֲ/UIŭ<2lWȧՐ˖Ga{v)=!Wkk<,f'r{βJKϑukغ7˶w>r7;GALE63Ɯ[zwF÷ |9,_jZ:/)֏ <(ˍ_ݏpDg dQ9*Њv Mi$B)#D(s x:!4q:XK*^ɗaa!$яM;휎ǥPx:#wL_M x!Ԏ|x =@Xo)w7o0ܹ$H'XFWF&CJܺAV4y Qkߘj[i~+&ubKH( ),DjyDD!I_c  !9-<(F{`& ' k=K9W˚VCOua+BcwO&!"ţ@r Fs)KHFw8BRs,Iw!p/ϥvV3E9D6Σ93\/=C:;1TX(f161!V]l!gY{J؞ɫlqvޭ*Qk͒w}o1g,p^oY"=^ =D8̐ҕ( RQd|L[oSׇ.BLk囯cqR5X)|2W{ij]@sOl'!Ikbe=mR$'6C8#0I:GI%NY`S0ɸpNPd_4(ӻFfgΜ约5dfN**s,P}S53s)p#mąXIB8 ?eLmw068`Z'>&Khr~B}:wy~ɥID@@E9cȒjFy %#!g^ep#Μ߶8pOV[4n8vbQ|&bᴭiO6z]`c}BL41rMRIbg>jϽωF.O #mUu "#_]5y IX{ď$)4<1(}|}l\kpbjYZ_gFeS}`0/A3,U6]Y7ȢDj\yQ܎.Z4:20m0%rR ]Dl+QNE=ԉ|ʃI>sn x=3X\A4^,>)4 )/@ʝ=C@M0Ey0nfY5g f4F.Vi䤖dtkxZ jV)Pfm, q-rBc!xGu{ԌOȀOrz%c,rr49 a:'D.79E+9kã0ц?I%⿭)n&ñDCGL[!<"|\ t:TLxcC^ ,oReØkw5ՁJp݁vҀ(&"S1[RS#<T34 Ux*y#g%nt28iMXRC&ۡ' Lۨ1ta:B&98˝\@d@f_:4S'T.$ g% 5_ZhG|}V#k:QHm$G^M@i9gD6` ዑSg;"BDR g[ vdo =E(c-SA6KigHkT{A^  ~EZsԥ^%]UsCdRϖc|I5 GC~UNԂ BmKPJ>.ŀ#Pe?dAjP!|}&3Zj.W쐽$&kW;!TJ "X3:Y<[iʗ~ѵE v&q+qY- C&Q958zo8H5$ inq7 n\m,+~ E۾oe=2w%NjN$38 :MT0v򎦈< N[:4x/Do&/e"rN$'KXG)YۼzO}2sILIי;8?rL[2z亽ܣ'eSÀ &*@7 b) L7Ρ^?[!}1;U%+jWCfV vC]$@~ce2 7[¾&}Lå3po{RC5',#OgJt9~sٗX߫mxCZߧ?m`= /#6q{JB$ qwV89.zRz=bscz67ObETߣUndK:Ņ/޽Cq%L"f(3Gi8?ݠ* l:H$s!R us*jx;cyDDeiZТmtjVչyߥfV*-e4ۄ;T^m,!_f(ƳAA+Sc8CtdSF1<}5ԚJ*9u Jac1*zٮJĮHoJpђW;JGFKG:WpR1VyXqc8D &67gZ )H񆂇Ѡ6 >'8vDC"!㜛F׋/ٯ"~ j2!U)P0n*/> M.A޹JI\Q #^{ GX\ ><]%jqףDYvX ޿2 նfװʼnkq?gxU]-uپ"An ҢgHzjb>! 1EaRH>Lqv(_yي4Rpo@)$p[Gqו'"5bB:E9.(LmɝBݡbL>vrv5hz("P|M"dZ3ۺ̞@e( Xddow.C(4>1rƒ(3"]|i]ΦbDYw3kJjSω5aՀ|Z}$ᵤ5*1wD 0xKבgʭqbјF7%!Pȅa2ysoyjgu/*/tkY3tpH@I:aM}a%q]йt[Tau)$ Z6rg%_ykͥba6(p=]'M`&j٧'p4=͜is– p6PC 6 x^ :=]+%"㧋GXڄCC!GfBy#HcZ]@u]|]I Q836kᡄ3Pctv#OKcWbnys,v;#HX,>+ChP^oy?}Kl^PQ5qv RI6Of虐R$/q*:Zp2#aO(]ױph&O:BF^0O!{) AT\'0qS/Z[_4NhP!bo=$wǎo#?AO녙+أʑw/u aj: TIBf\hx B>qHZX5~Aۖ:Z # Y`>P,3{GT:Ƿ"7A%bIoQbYZx!ɞ&?0VV`N^d= pM,L0ese=%FZhTϏr<n֔VJ{uB& k^;x-weNUpX/ x=ܨ=͙-\l :m22xzN4R9*Nc+M7u1g]: #ODFV=u3=X|V:JfJ{K>Ŀ0x=gks*L^<L0^UpRamr>2>GaÚb%;S.ԚCc$J{v}"4+VX S_5% 䖿XJs-?8Cbk0:&|LHϸ\r]E3=ݧom@ C3!" S|W[pK /jXM]jgw Qyr h^#~s$S ٯVHpS/#bf.=ܾ̍>OD b++I݄?rɋ%$K_[Z֟q\7q fwvC mF ZgLjqw+RL0smjm#Co1 wq%O?`)",zEhzP!7fBy1+_ ^:=it]>Eړm帳aV2p# 6(8D= ]v78Y.BG uDVKUpjB!?LG8q(sqmܥ;fZERYBjRO槾8L.mjlȢBZ#dzHTIrܹgdTQyܫPߟ9cCa׳~,άMcrT[u/H^rGNwxԝ@Oo;'C\s?$K苫U@.3 cPfaȫ~-@r&FXYeZfHe`GэJX:7 yoN&%vkcBu#(AZFc&w c\lqV7Y-m (۾i_P>/\DMp^pՏ8 _i c;> {|%˜6I&E{1 < ]@WJaDZ AT` ]H;MI6*/9Rw!e<JIqH#o/a`iʅ̌ˆ\^|Cu#!G^fOjh Q%6ܖf} 1-"s|?N: ۙD;Zg=^N$3$\?rGUtfCt7GZ& #|ntVQu{M#v`|OݲOc.=f3ք߫P@`;Gco9#JxdᾰXT;µ-v ߹ S6؉wc&nu0U+uUc)민O&&o,%Q/S sE{.8, 1 bM\V;ף>׫ä=.'\ae?-o1 w4gA,~ &V(mz7$M$^y=?2{5TxTyd+9@1mWHERF:O@;Ѧ3jz`qS]  u]%;44 aⱐgNߨ):(eg7o[ha<$:Yu%]'f-.܏ .Dm8ŚiP1 h>oF* 4A#}Xzs}2:5L0` Ex+Ǻj &%o5hTHM߆.Y[H!9 ͙lZ{LjU$'(}sk9d Dʃ)vcrB}D4$gp'b-)qtޖ?)E#چ=s, 1Pf.uk/]!9adp\HAr!ER 3:G ;hk{ރ4ΈTS i{ffksaT+n^3R- (~bA̽EZ IfqX$ E}3s!:=3H UCVd5fR*{_m]Lm.n+,vbS<ع-($lsWU[4Z$ݡVxe#mW+I`PZI!d7)yCL}.Ro>evh160,AưBV1/iz Ty"nYb8e"<@[c$ЙAb ^?fǰúD!Fx[ʜL^kHoY 領 fS8o"Ʌ >0+v >"fS{MA 3 ^>_M^lb9ӯT@sRrRl˓'{ᦧ ̦dUJ]/GքmǼM{l.bV})ŧX_W`;/J:yV$ CHӐk[Is cf^>TaFFtXiPWd,0o~ҎsǪŋ H\7|)ɇkJ l#~$]=fԛ_#PRFZd[SHWgg?vXѣF#Ԙ3X"O)ǯ&FjkHI~n62Q g49(}g%{w)V?¡kv}\͔  D]r4#b縢lM̕\F1I- 6 yN)lelڈԽmJyM|*3fkV _/kPhY2W$ Xn DOCoEaJDX/NmQcaf-e͍x՝aweNxG0H Z@oGTXNVN7_o?b4TMC}hA޴XVC޺}!jӲ^^D وA{tW¡o[VS(?@? KX sk̷ad hݿynȍjt ;j +[I{M6wɌk=") ;DG9KHgq5*S]Jb?OG3Ac, t5ۊ]B': @Jݧf0QyUC(*<|J ))uU+-ʕЀ- =-]Za#cj) w?xԝITJNء\vp&zKlA(Q̎n6ō (ξ[RK (yty%SDֈn6 tԡ,{6j2֮'ԫZEd?tsVkޯ7== :$ ˗)ZOHʗt|!d{Dx $ˏ0c >Jr~RʾMݞ#r;61\1 Lt<9c[C[RvàFRN˩1WB0D

KbqCl#^Zouմ'.ea X \yb''s+tyuh;Eyk"3DtYqWhc|F˙TvI~p$CݫE0AY 8Y嗆n}Lfdsiˬ\CV-NCeWH qIgf]j[҂Si:\"҈TW䩘j6dvsEQ]h=$k_=c"]~B۠rǤPRj|'p72'HɢHd<Еb׽m8⨻ʟnRt䩐oXkПХ_c \.,.u`tJH|ӯVbReag.<S6EAqjE^mNɒ T5m '2'ۉK)*wvZ9YXJTHOgJ?E|{ H\E|ZB*6jaJ-29<oI?4~c6MPl5~$1>w5N[h|S': F` t^i7n%?[NNIVJOD-Zl҃}2tLu!, |-_U+t*NpYO3AL77y9dOM0j{ aqU[qvX 9vƊK#A{3BLb:i~;%NbG{+WNZkݤR9X\94 gR;WK.#[#y^R[t$3| M _V`}nߋɋTL=}t:(+k}Vk99T:poP~Ō<(BD=ӹi%G[/ sᬩA+s% ̄9O2Y$B_TR};(m5F*5m cP휻~фEP)-Ui ݁PF mL g{`>-bAT|f{ս4ӁB6xٰ&I.]xDFf}a4QU~a5YISH*-׊5:N"N)]*$AEa 6 fW{wVd}AN*:Mro ב>/?+qp4&Oר'ly/si.7vHۘ (R?^ʏl.|VYܲLbAs X֝#aXwVtFפB Id-J{4KwFĂά/(,KpXgRm:5@ɠ\n_X9:pu/Ju4{m]%Tɭe{]&2@~RM*LGk!_ 2Izx;4QWi }ŦZ J.e!C]{`ۧf(y wKpܰIFKK1 b+q ԌlgUu0/5v1ao&I?>ipO:(}`52s\ӫXOa;<~6\({5ժWƛsFԲ6%#RBHR:W;۷(4PMN6fa7=ZO iɩPX0a}o~$pM].tfRQ&$*L| uR2u@5j\MgfÆ#x!B'(̘#*?uNH*CRhDk ]r'HHU9RҕNu!MF7 V~ؗ$~ŪC0{[@ߑK /7ح58!RĹ VFysfӓoh9ϙo;ӻWPFW ُnaPl ?0SUws[$Xf6+ <@r0s׮;b8 &n.3DqbpڡV.v LZol+L8V?9`LZwWȈGI6H>ZmMXQw lsT~*!xc5B,y<˷P 鑲 lai%InB<2s^Fi1k0[I[d:|'HXy5 Sb㐬$סϤ2z/r$nCO頳1:%ELxB[v^7|0|K/̕c8'>",w2S D3XwAV#ͱOm*Tf;¢#:N_n }yܳd[U}VdUlTB nGmK[3mgIUlqtq`2UU.lHGGYp_pma vn,&v%υ8Je/ʝ\c |lz ![軙EﻌeOQ.\ULS=;*rRqs@H!E#^瓷M+;!2D@mf^lͪ|9s A(}4셭nR-מCO*P,pB% Pgbe Qk\&2ƒF(5V v;=io ?s(THerdžHLW1QOt-ώMȀ8mrو\\I%.>CmeCp҉E+qbp/.HX]2,6ل8e!~wb}{*i8*|K&?/k0eCPu_rjΔ.Vgan|( C]PDR(TG`FPiL]%mY/& '޽lK8,ŵ|M'r}T![$Q_=QLM'`Ȫ٬%qw:6J:.=J.zkRQVqpi@ii)¿7q0")ppB04")/G$*EsyIw Wա3Q OPniXE4n#:Yoߧ@}Q~ˆfЋjYha=IZfMĉY 17>D_p,Ϛ!=;7>_/ 1IWwp'P8(4E4-R 9{ĨY\֯)8(nE7 a[{Bgǎ:\$| oo \5Ț}ɋt|x!ֵhiLz}%̢7KvD9eM^D_[ Z8!o|VB']RuWw36-~&}Ů,J,ȏ!r4WJ-hd{ Ѹ0B;Tsr@7p6y NS A;roUSFǦCY).wqcJ (0s\l@㫅?RdTKNfi˲Gg U@H]2F7?&a 6l'6[iG=Xx fQ1^+$uIImqo:gX!x΅=O Oլ/-Kꈪï9Ղ ` @N߃aTz=zír 7*6#ى d+QKRtx_D ܚŽyZm%sxȇJ]A0t`ˌ+lG&lF$Jx~W͵6dt/ =!ܷ Gdxv^XB?ͱ(G".Q w\@* as@ Yibzḻ:fy]I :^hp3F8Op(^[|.& ↾Me&g;+V+R>@rG ;:z3/X7 c/gl\1ޚ"agNͭL3 @#j_p4Ȳ3,sR]btiq{чrnޚ,]8~5V(Yz8W6eɯeٰ!q~%j/ڣ);=?{ 0o-gw,uF`ّ͓.g}1<\@1}A{#Vx4[$b9l? @l,^Sg"c|?o )l"tߞ #/7đFeUJ~-3f%ޔ_&c6.9V$w!R}}Η'e O\$e {$OίS>6rt)#=pnxE"J/7#Gt<Պ}Pn9+:Ǝ$&4?YJ[Z\;^TQOcŌP^3 쮿wUOTH(ޜ?? TdcJœ[ݮ<>5 Zj%CVЅ+C)oai\y0njbÓ$FK 91Qb|R:,"FN#8'a6/5YeB`LJ(܀PXAÝ -gUd~+Ge:EyU)fseE+t^4bn%ZZ携`D!@Ń 25;36£ TF `y\\|KAnG̔G1JTfl=ylVQax~,Tt"<vwZO 늋s[|eb7=KOew3/]:Zp;U,懥DP߆܂_dk{ lkfiUs<_Rn U+{1_݃SG356'cEA>wI2qu|9ni ܸƥoi,\IVdWchѽ{Vl97SWt<-媉VWwPKQ(R_H6JoM5z]$kB%cQZ=p! 6ߐ|XL?f `f}B&3QR3 lGu~9Cpv.aސtm^".P`]+LST ZIJ~ GI$9W{~V#RVFeA1*+=9A_F$@ -eƜ~Nk"@MX2V`j׽wG|>Ҍ-ԇl_VѩDIJ,>7("wcnI~%,3O5AG*n&ȡd4~N)rF*7qsm[ D.e+@,m+fYN@).'Kq 8 E 6@6{%}"M#spSV.s4ɮĉZ=I.±]GGq*|n8ZDoV3n/U'*og#r՘[NNL`s\m4$3ˀ "Adtya{J@J)3em^,+Md(+0;6OGf#K'הS>|!}:rMg>$kVf._Sv7VR;!n`-S]~pPOp0\5Bɣ4T{e-rv(N';|5 \3`z)s^>ϖ?m' b"F|}V`=lĿlqP f p%phNG eH6%`+ynٴ2r&6~̑|=dqiô@Ǜ^ShޱWiՁe <)4r440gh^~+] ,=9Z6/=#Pxx^,g*W ,/m7d p%+5cwf~k3YWU+9>.ִ_, uc68vtE]C;eJb 'BR9]1t:eرwzNm& A Ym7zPߚY$<#` u uf ՍY7ݢ4%q3G鏉ȓ20)ELr:1@SfCХ}?OgJJPmo4d /}]W;%9t{W[6̸p$"97ewC\.|謁 dP9}E,h`~.Iu,宴5YddBY4z ~ҁEu'“ϫBԕ!\4>]k'?Vͣ#WH INTH NO0_%ݳQ yk 潴%ә?T4T{-l霸@nHiVITQ"䮞U[4NIv=oi`gZi^Lq2o$`fYړ~#7>Z85zW,h|6+b '2!%ݏvabX,ni7I0m_Rd4<)71}9?8vqan;{L"]J&hg""Y-ˮ)SBj)Fڎa8:]&B,<_XlruԮq>5QN)L"#Y\k Qew3,@/P VS U® 3?/O8J2\m;~!CXӒv&Ƌ}I:+Δ2I`|0X+o! #St%t߶\LyL{uE%)n+RFÜ#](*dϒI1<'¯$mg(촼q?m2 +3}Ʌv:Ǟ=%Mz>ҙaɞ?@şީ*~EFPTx_.aCwrs1.a[B=AOPւ0iL).Բ刪2i[xm֘H)/y6Ok@.4[jK'R|&.IUI(ʴ@ߥ)aZ0"ƙI>9Ù]:9U1gM!%'"DI6~!Ig`T/KP%Q[c=PF9+p9~&X2 3BdZl^iHG{$ Ju+,ջ.RGbꀹY*>Ei;+nUdWd>nW'$єRrMY{-wgnSbϯ#n4_vz @U*5J#htAL`/ cc˘?mVe)>1@ ׹(Xm!1KљՁ Zb? }ITyRshujd[ 6Ti޴һxSf]ťwR[?O=&Tӓ2&q T8q`\Aϯ"-(ŭѴ[٧5$^4Sց2xgl5Yd7/j|T5& 2C|ę64FI"t.| ۥo,w+Ͻ Qn['i#zY7կAH{*%\Hх\0f@"g-h<ʒ?.51SxEafWi/&,fv~G!u ɀ|P;j )92y)^k̥Fb7%K8˂Dq"n2%OpT7 ꡊ);U\fblë1VoTfQ:| *z; 4).n]v2?gmd-j,IEY'(>(2-4]ql{Gzi>ElII@f}?|RBcTBZ1 oH{&[D.E3Eddh<>& 8(^13IMpظqosnLg;݀=߽ s?58d&01K"jeROuϋ[E5 QCV[Dz;`J'ȱ].f 9ҴF*B+d+t`T K/@52=E4t jrA=#H=s^3H& HS ̪A7xi_v.9Dӻ_2Fja= U#'&=dyo7hh>Pz!<Ţ*o - ͝2H^^|ќ׶/X/ )LxG SC5R-Z_*+P6K1o&'\lD3(eA-.gH<:a1l5}jzVDxއQ"*^.]>.lj#xkY l'ʙwKJwt #XD>;M ΑAW}hW"Z HJdͳ6 @3tk_^E:C 3LWBa0.z2}x x2)v3VZU!ERӒ/+ը|Yd\Ә`*E~f咲IYA Bd9KZf@lktU}eQtQs6I kwRFF,?J#(JMX@]IdQAk[]lC+'ԄT༡^tk͎KK92mgGǩ¥5pZ>3h٫_ұdN`NJO qKj ;ctF׏4鸁w2{]rۨJ]DZawL7~E܀FDuy.Qi3ҭ>@kr}Z^ zڣHDkj\q΋kXQ@q@IWx5{٠ՈTG fw_7H@>w( a<$l:Dɜ+XNJiY{\*H_]Co."CXx*Xr\3׎\?{K2CK&k v-'v].`6Xgo:9F3J'g˖Jv!7nup-)}fO[L cwj GЊ%m$cr(`n!}} O )z\;z*gY %oF3vj¹D/r]t`.;WQ gB?_5 t`` QX/SZ#Z(o}ls!YdU1Vwzv>`|eڡHyOһܔ-r;Pmh[+W7#1@CEXi'.qf Y7YP_=ܼO5`EfCsSt}p3&.^G!~5}:Λǧ:6y$Ա$4AB'Rt;M@elCqR:wT{- 4!ΐ1~]0e!T©s$NE2GG&[d|ɟ{qhjh۞؎aZ8 9W*6DDǩL cg#Au_Yضa%>rsb[E6[|k?sz)g$AʐD^@x ׼[ "kOj?氃<|x@!Xp[y Tq?Zk8!'P!9B7.&KdJ1r2Cӊp3gjv{*=ZKxnt Tj>)κNDH/Jy;(|XتQzSe׶Tshq5_l%ZA s %Ueȳs wl 3$H3Ii;\-00Aw?}Nʓ^@W%5VȩchDC2}53VcFVyԇvTpPM؟yWX3,*Z?j"r9ɜ<*}NxWMNR_->+eB*jty! ϰP6^҅3L7vafn+q|,&EIOOc]a 96&J#xLZBG(PEow!:54,wSy_Gjk#X[LN{8E1ł(a*;:j =& _76^>oɎْg\ ԄK仕u Oo=IO݉ te%K8F$yy0vSruyϫu|@gqk}y-uQUEđM^\wH /PjF4%7[:'d͵ob?Ϗ*gWNިo j0&0Q z,@UY1?&o$1kGY:_9u# ɾx އ9C_h(j;u *ۇw,MV5n{|=^[a4NoP_v aŏ-YԹ:~HRB[ޞ,'TWLؒO3Pā"y"tcW7y &3B!,Ί 4FÃ+EF/2-3_LJ@hHzid#  ~q²cXRXD5D˜I?m--Mrr.'W=ȣ`ya#OF twOGg( {sP,Af#R/0Qp`g~nfؤ=g=6ߩ=,Km.O0(1hc'$:]Aܿ`2XmbynAŗJ xJ.нZ L&٢2g bFY??k[biQ4פ d] Lmdux':G.ȵ{]6ZbS0`<|AzyЃgA;Z3G[w ZuEa r[=sUp#p2ܨvcg^`矕|DگU_  `>_{=5Un8+[uáqLu ɁAVb#V=)l7Liqr/K)<ˌB}O\0F!,ӟ 8A,W ¯lx*rR~AV${wG sJ8uDP,Y|r ,cF[Ib2s_ӷ|%FQR/fe5ɱF&tEh.2LJkW(R#c 2o+aQ\ݽDQ0BzqZ1d }7!|lB+eR 5M ]hADfu5Gs+g-_08LcnJ^0\􊈐ND Nf B5|*h(O) xKLk_+wj ;x$3} SXk{z,/ƣW9nYZghs=sCd!G;:[ @eyhΗ:aoy^7v|m `T =/{xS^^nLBM ? O 郉A?pO@mĔD`s0B9I~E/4jw_c?iE`Ǩdi qLEGLŞwXkZE*jPĞv3^-$v:X#{y_Z=1rpܞifKLg'E9˻"G] F %*bsbD3ax71:$/@ΒJ/{BS-2_If ɖODljo&W5V; , ~EUAElr-cݩ|QPxg3kslpٞk~E޺@=4ܥJ=-Dm"0=兩Jm`SE6zqrkQx;ʩXi12CY^J>@?3EJ^ժwBb&9d,2$PW2  z8ca &ҹvd4J铻hMWh2ݑ@o`;z'8Bp fV'AxNBc!Q_(72"\7:A֠9NZ[B .Jqúl|y6~nl v}E!fpgU;p.˵ЌKp )>:3jCr&3j v{ 'e_ Y1m+CVR BRsׯ$'/!Dnj۠;ӡ0HOLf6% ,cx //#hvSJ9(.6m>E9g.Ѣa J rY~ !JT)-:&F,ZA(1@Sv$'ב|TWaCӶj'zb$%֧ (E$B -ЃD=_&a; (fIPHե/Tyh*)7 5ˈ@IRZxXa]+{39R,,@\Ɇyu?ɾfk έaʋ wBſI %7J5o uaAڪs!Bc5B ;o.qEc'kMNV/@_u1';WpJ&܊5Vz^NXmCA{T~@|=dGGd/m‡PT)K 'LVOD"ej-K2j;K1ݨ4[4bi9>W)p)_'ܤΦפ5Qv_mK^yIv8̚˥|Z8]jqc Tڠ~ qwD=Y1-m66:qyף֬mvA$CÓ73kw"MN$p^,Ljy׿ 0bە\(g!k\d*Q#tǎI_vI Oz[x(o ׌IKcbJyîM㕖PBƬ|Dӝ`sׁDvm5Z΂ fmUٝ72H|| `V6̍FeA`C#D{Q|p ?S"\H%R5L__L,)El[$翵液 ?6xa$)Ȭ&`eʢߜ5IŠA⸨Cu[xdS\L3 Y BJ?-RGg.SJf;륲a 8n)T.-kA吗ʦ[_5͟A%e8x/ ޚ7ݬ&>vS9r@[`F Er!y6=#SQg*{ @ xx V 7)dxR T*!~s.1'gOQ>Pʺ"렢@q,_.7z%c[_xZ$a+maovO{XeQMcwS-XR `4``b~|˫D}zEuͼF^OQM,/-*}6(I$]q0 p9E=fLk%:䐙+*0e%*VIX]{HyJs ZP&"m#Wn<{ҖvYx [i%B~*/00+k;7$v^xx.ۼvT0;syE3В2XGeU"0,j|<.wUO\ ;gM-hUV(4Hhfmj4omP@6}bE"ph,:(?Xo@b 43R"XSgkh?wGi[@ 7NQʅU'rAk2:Ǻ S bKX]`a:u1(!aK.Ij;t.]hR_˹O]-uHFB-Bq&,Yc# =Z5z]Zbv;#Ƶ *>MײcSs1q1mkoÍC:$fU'8E+9ӆfeOya?y*^|zhgq&mڼʽ=,`ܐWhi P5L_)v P+[cn3U?I: @]GE w hT&ܓ_w p,fUaKSJR]`~YV^#nİW4j} PP| uPiLM^ɍ=xZ~_J iӬy{#=EJv'N1YY y>2xՖ9ԭ墹` †$xe1<6KM,e^Мpny5p=rx'AnU\J睪~h厹Y Q@s}tk$! /]»b n{a-&NhРV_y UVP,ef#]rq:(]KCc!jbz]*w]PժsO v87g7LL"גԛfk uu\ +I\"I۩9D$Qۑ\93hCr^|~FdB9IUBNxqTȸ?"E脎$-dzh< ƿ8$,( }Hl3n JІ+)ǬZYxS}QR[VEV$a)4fXRG %mP,L Տ(\PӚ]|cvV%8gvC YW))L۳- Dn]?yHDvbygn[Xz!nLhcHfkm{lJz{H8rjB8P=hǮG5dHڏ#8r)%sROje44HbGU֭d2J2HJ8{dXs/5=.(¯Z~jۅz b;)Œ{wEa GM4aښ` w#ٔ=Iq-6JxHD~˞]VbX/pg|X3De9zAJs)L ;*b-)Hgt ۠<#F˩k0ehۘ[uY. b^Lʊ\['Elq^;d}\g_z&!6 wt=UՎGRZJнvV!WȃHiYᇴbpBRMJ?M9}nmǞńy4'茠wBH˺oJ=S8avN8*pep} }ހzH  a5р܌_}Ø8^_!m܉n`x Ydo6dUkHr[xK<{=Rs3PSR_djh $ErP+'z tCMvPÍ[M* ^IC'Z,_  B:DmL:8$*Rfs*̼ G;2L>j]\H~?]|ؗ-+vrdN@[eѰJX+a_SVOotzPd̡7EM1_h@V'缳c}d<_v' jX>&Rn:v}vߒձ; gH[1m躝B54[@|u=nJ}ށQ0Z̴zo _8/7 VcbwA5ٴDI},, T7*G-)S4M:9H 9G5+ؔu'zɵ  *"_e&M?4dZ! ,$ mfq(\(Q,P0}4ۗ"$>yj)1G-P͈)Xo8j5ZdfT<įO¶DbȦLKNCbW[yJiȊ:' yB&6/ld5dM^:)6ǽ]G_Z@5c!J.:`]RTH4`J HٚҾt~RCTvNspei: f'usWߋ|(Az.-ە%LP\]h5i0g+9N49ZNEKs3U2:4֐%0.\NɕN Qe]L">l^nlJF-w­M=BG}Q @mu‰0-IMYM  ٘FvUx/x/"\G<5m Xh%(7j)33a΄=mq祶yto| `ޭC4nu\ Ki`64hļ:ORzZ0w $UK_Qr'%3HSGp o9G` ,^ӶBi`$Nw-*NԷ -ۓל5/19Q2q ׿-!&\h`n %}Jgwo5 G#eθɭp' 3֑ f@ _;,+Q v4Np c61^sVR׭{U#x/Ks>g 0J@p'lM,5x{nˬt<& K k{( ̴Ii-)RuYk$2 ֦,G0[h^U+| !9,{[XRK0 !"C_eEc0yɓ.fV@cc]EFg&]w<(I?rVcO(;K ;TIUMF/10_H d`;S7 вqv|^GliS}qL?qoJ"042=ww/;[H'Y`p˸-ڙ{ղ:n'CZ'ˉ"U -'W9 V>4^Mi|CpǼFgg{Aammx|H 5Q Ӑ{+"hx`ol9l:N_“Tb]ɘN0]K@9箆fpXXi^yeN]ZcD =BƝ f7i٫}oG"I5!&;Ze, +l 2:cׁHNCuR.YjӆȚ=?ws|?Z9֞HU>S෌ZھnDNMNC3p7/{3շm A8.泶{Ժ;gӻCl/wG- Qb x.ZOy <LٯyWX~bڄL}^Ŕ"e&gpF˒Sfbe yE GGi2 ipG_,M4ѻ \̽eZ1tZǠ]^d.'oh>BR%;KT^u0<3dG> O=8ż b؄+"pRBʄZ8K_n,򛈬y/e;͢c`j1J! K;nWW" 0A%Zt $X%2\tļD؀cat&u&yjM+Qg'1=]ge]VVƄ{]f|<ߣվ?C֞Dըu˃Z)|tPRXaZ}@uLqsq!n&g}"#0ʩ0=VNw~JPW10h?%ilO%[Æ CnH6ܱ\ґ26[^xO Iúwe'\}4B~+~JhݥV慴(a%GV^j_P}JweefcT `~МQҏP=3xd@X> *f֕sf_j'D4PЦ-P?z$ Zyxws}Jy(g+pGw0a)N$3dU"ʕa+gJEz^UR'G /ſ͙ <%J7aQRɃ,l gs+*ĸsRMҺj 9߼m!_U8R I:j1[Nc8[.L`{|+=Nfi/Jb~A>fSKۈN盏)&-S;(XJݠEo%X^8HW[`M @zrؽ3u]+/wN.Ym$XHf;opdG{6&9s+vF> 9lq3c/jOg>Xd9b Xp5>zZT6஢@1 AKn) (NWr}zD2ĬW˲09:>!jٵk6 \:^Wܘ=x]t8f5gj?ZyL]_Fc/"/h=*m5x?J_Ĭ,"LB<[K9=}ф5DƵ`ʏ"]ՙhw}zb5^$u9f,1$9BЃuUw^bGO601bV'>Zh3SYߞٲ䩵i5vVFSzCv ^*݇v y,L5q ~-q"4;}MwwLQ`2,*?y?]=GflTh s&dCih$l})N'FN-S5p[? {_|o0b|89P ~`>@%TaΨ+f ѧDQ5v!.- ,ZllMzvhpx>yRlvׁc1|EbN=sN=ʁhxN ޱV}YȴЇev}㓚'~뀰YXɘfIڞK)tBOwSQusLjd8͹y!X;9iUo^sfm!&Ga 3wR8]ۆ}ua w#s4P^\,wπqkv1 "c+LjC>0ĕp̟=sjDOr`kD>>"eb cк'#꥓©!Пn~PQ%EV)/;{R.-e(D]_ mةcsJԊ =M۫!8 M6 t$lƲ 7tSHN:PbFH`U5bujӹ͞$-R?^: Xfݞ,ӧE]Ffi'dSqs֙91:_ ЛdGc}]͂?Mn[=ZaE"Xí̏!X԰NҢݰk$R`04WqT׾oǁRmJ柠FSjؙK^{V/(8bxp:73Ήa'F-*B&$ĝ(.ś%I-9e rvw!"ċ(46bB9Qy -1 +6x4xz-Ο@D-L 2I_jդT0כ.oDkCj)):kޗʤkݥjMInM/g QbzL:s SiKqMhFw&ku}5*[7bbxcw?$ ۷s|U?Xf '&97a\ p$/'P^N[ ?I-Nk 茭yCvs::t(9U*)G(E 爸lM)ŋQv&7EdE9"];+dO|c ɿH@ΡEVnk0&HI|-K/gxc] +EuYXzbsTŌU9V|w ڧvO(rNO{<A}ivԉtXdk~&!bH+rG};*W?/u,s~^d@@ТvtnӉG !R#̲9` eLO9\ ںtBx kP1OB bn69*B awd5HW/R[ULvrsk\ܚ7T- =u&C%%)' ρZaG_:ёeR[S]c&-\fV!fBWaP/ƛQD^kNH+q9 Uo VL8}P.3Ñ/ p ވm1Yqz,gftVvNDcq S> )67 ;G69zWQs07՚㦻Lŷg~r9€Edp[Rc\-MևJx548b`驊!wD%P۩'9c95jё׿SZlPb8%oNwW|[ML@]njƓpbQd"F~q yH3bMt=ykٙbk#F;5h.L 3*z 0վOДa,WZNd7W(G9ʶ6cK">>9RĜhd$i [7f1/oSI8hqz SGrL.uLT-]ܓ:'NFeWv!Y&JlǏl ې)4ouw:cSa )fZW*Nn1xl^j_3sWLPrNHvejY(IU[7.S0V6 wnm;i77$ a=|B`$/s\mtR,:Xi顶[r>/۔QdCe!&(^+h<a aUsk̄M}М̵7& Pv|Z@-4zɃcPԑigc,њǴ?/w"&yڐ1@"!ç/Lxբ_Ao%W ~,dU1"X}^h2q][tQv<]z[;(Vڗhq7A&NByOA"E訓C_R&iDqlPĕ.qa5ZfyVbF*fP̓a{Z5;1MI<|lnwJΥǺkN_{'< @v6.<3dr2rlMIH,/TA/6_44~XѲ=7=OCd뤃= f <ѦL{㩰iUB473˷1$sB@sP03-mFsQQQsawXqF}4sT/69xRSa5αF!UsjӠlu{(y)HVEg~4x^h;ֹ SXqvGXź'ϯ(f.2{kzшJfBƼ²zcƘϞT"_>]@;[ 1MiZsjJN2cW2 3Xh.SiZnwA֑5UDv;qN,hvt31V<1RX~Q['(^[mB MQu7+YK߻sTc䚇"[V{F誈K =]0[&wZe F6nι;!S\q.ҟ+Y(3MpYYt;$jb50tti;?+ל1s~YPJQtOܜH?:F,U T D͋( ,O`E!^5pw=\WOXlSg f.# Df}j,|XT&!LɭcQ|#D,S`>UUGo[*ܯΜjw\Wp-,qI-|@̑`~;1*u Mu_jj*=ߧ+7,{.aBM R,stsyl&`P@0IT)O'e3 ۠%!s>7 UU?W-q םDFZS?%g n$h έo=`]V.̢NZ ̔5ĀKC%;9K;E]k@`9g/+Wi/O0U3.S"Q-}]uq܁O.ߑ,C_r5l5RlDwO UWJk - gґi>\#SUb1K>mYE#h%jHyXbL):ޠ#LmB<x[g++wV%#(۶O^A?A$3O\{0NUtJv|S8K:^tzXIG:ne5 XI=a؊y&(F|VØ`9\9ubzz%F|G]4ȒX|؛ κWvlU*KiQWJz~7(0D?Q~h stkgm(|uc0xlwl 8o\ ӳM"ԗh1lQ5p;0F(Se< M?ļ/A&cZhJLSFa;Z_EļA DH|ɗ(Gx͔C%8b ``GRM5a(HO`85fź %~K20D:궐߳:IQ%M)7TK.e-Թ6[ y G0x峋}0@UK?xc?0+]j 8!n;gaѫpz& w=8Rld%zς <ˠ$'CdHN  X`%c;8>7 p~*f4`y^8%qŌՔkXmT%%9+yr8>mdFYNC5GN>4~E$bAB~=VR4_jJS mfg 4 e2zV@:ܔ# mUYf4P"FԄک k{F8L@g֓ڴJI|aǍ‡N-+\HGڟ;BD Һ\eކcP ^TšÎU"b!sMB. ׬y"7#Gd[S+jK^qy CZ&ӝ@H1 p*+TI N`n <궊phEΈv@o0&gQSRYz)^fUcq>e7D2?f zF0'_<55f\`[_`Ŀ+V= ˧.SŃl4Eln>5fvSpq8Mrrs)ewm^әylp$wN F@7{Óؘ滉Q[6 dAAR1Wk&| 2 ~A6s\<\z0졜Tk#c(푂8~V`´F@wk\w庛ǾRj] L}AF-f׃Ti׏ 8V_ߋì͕V5(t2.,ec{s74E fzTw2N-EGWd%{ Hbj‚JeRGZs ;ZLk`Ws`x'7*_EBۓS }W#DXv(0fޖJ$H~9p4BH"cŎJ9Gŋ瞼}W7Ls M ?CâiLf~WtS9(AD.N[Wq~qIu0z*i(zG["@Q|)ܴ6f_RmV<5i`1d89;0JA*ogY&XtA|кiz{Ѥ+eC.nQ(,vieoN!sxR=tmKv>:3i89c RQARE*Bѵf`l`%-fʹz`2z^=2PÛ&;an"H0KK['(q}eJ0ih~Ƭ *`@q^Up%I0E@#3E)%a #]o4\Wy[)45}~$68%Ƥpl/79zQ_LWjmDX66:5AE3U-XkOxk$$̪#i?JEJ(<=nEDC*Y->ˌhԫaĬnYXv31nI㘆&@!( }6챃bc݄CBr`8JoKD:Avtn5lÉE~n PCs}ԗd6i|33/@YJ$!(X),\n?_H.:8[ni?mpvf̬j#\VmK}\ArH 4mQ lJ. k1^U9n5csܓZ$S!i eXx㶭rn4%{ͯ n[gr \;9h M]'/"pPIChj*sl ;m,yџC60a20Re`C* )P,Kɵ4qRnTFmgvBgٮu.ԭ;x㢀&Ѡ(2hgk0gW"i~\uDALC5pd 볡t}m:%NCixE_K$T}Y+n!w6YsǕm{[´#YMs aXh/,(y2F᯽ 3IqT ?4$ՓYmG,4 H2ь߸Z~ԆGrJʈ[Rud ]s,b*Ct+9ch42>md=;BJťceT~fsL;P䶨ϚPod@? p,e`KnJ(KXXy ?-4cfAr& Fǜ s&@]fTpΪ:3 wmۡDMo>3dE4Ϫ &WFS$O+{$sevas+(x7-9MV^G ^khJ#EfʉfBH;Ku|\Uz]+y4`noZgPz_yA|@A )j}Rry> ndwn|_G hCj ,?7~6f9 A[@Zٿ;ȭS̅"Nw5g$J4ÎX8/A;܇fUN - h,"w:oF|uhH"?MPSxCiDZLZ_\ތa\`!W@EqKL[i15F}}s/&?6e&QyEXĔ=dv(_R\j3x H:=:s75֦J+ˤrupҦ :Ax!sgIBragXW"ͨOCrGRVO@Wz,hzj5?35Y(\Oڐ۪PlA$5n-d0  D983h 1.N=zU+hN OA )=tamE( S~〘S `"5+"zqIj pI'iп68<{8VBܵÄ%ǦxR*v*~6aQpXpF—Irp^0se@pԅj@hhV!ȣ g7j$-R7Gh8WR۰e0d]֭K.z|v `3VH?p 1m - ڻ iɧc>PB!2ۡ֞C_F'NIv}n|g--Cp!Uǭ8[Y!(:Ї[_Gb,<+_k5Vf%;5DfV:}2܀1"˯"M^s%] }#E 9sVyMVYevTq kT>SY Yy.3Rc8υJv7Y+nt4aɸ, å^9Gql.4szEjZ>1Wbfo# v5Ojq5Ng ̣ ;/HNPfXQXg6j1[jS&B-d>?'Q"r* cHeqU P}4k liUpS:^Β m).A(?ScX_?|ԕßUmt%*QnZG)* =t$n{@?6x&=a1x֎ɮCnB>(M F"74MOU]PcR+L ́~F&-de=LE{cLztc2NhC.TF eDY)@YY:mǵw]Roz>t!bXzFEqď\@w{:J@/•?x> -N';qN /higo쑰JDcހ4M*O؊pwB(fd0c+ [s h{zճ8i&c)Q E4.@=-u˜8]m[6[h35XO~'(@*90jiR#T,o*%{/U#pp{40F пY 79/`"`'$}"xWts[ЗG-P39^6OY.UNЕ6SL$)ɿ4,M.ڍj8'<̵v<IupAU4D-+ ¥G̳;<>Uz߈.j0OE5tQ`SBEJ1:ىIHA=fbȪ^f9l0Ig844 |FRF ,F!"qk-Y?ޑflcfB~1w}FL:Ga~ƢVJWj?<;7:bV+ї1..?LKf|<-[j8is͔_r~6@ ˶Gi5a{r b (jv&u0>;B`ٔ "KsZV"@*~68{̈́Os[m{n)C}@3#M^ƪ#-YN K)(%wkNiu|ǹ#(*w7^7j9m6ZAۥ',蓢!-qШH̅ЋӽUb/dwE vzj2sek1ɀs;^cblr1Y8ŧ;6L\֩c:^.jC\WVI gY"KS18"'O3_x_UV׀Hk:RGJVbwWҧ o.sɓ跆}Q-Wհftcw:3 $1rs ' of V砀g\#yHGtzY0shmwl=8Zfdeйo|D꠲$GP?eSԈS7,pt̕ aV.6VX*W@YV aua/%(0\݈fjvd$Ud= côأ&GB ěb蕬-ڊ/m:y e ChLn@.۰7(ZF.w $O\zpC 4QF:4'y_۰?;Թr\lm;-MVPUδ5=+X+aexʛs#Ke:GV\$:eABEeTǏ(TaAxO"Q`fQD,[\&I NZy W==*c!ݗ/Ƨhv'N2W*kW @Qڎ-d w+;)5V:+!uwzrMww׺[dx`!b܎i"d),vUr{T -CmW <&1c*qvŧ?V{Q/sNHxH % E?l!+9˃H?4l۬LTG8=xdggfϠ.ݵZ^da!Sl|O&*am%$qg>[fSϓ $>*EL k,0&90h}Vm$?r^`>8wžΣ`)~,C*s|u_':ѣ^p+J,+|FU>M\22/Sr|ߢ3/)xY5w c?5ÜUҝ ~t=)^'ۈyeB@@H]q]y q?ɥ^ޱUwE=WT(nnL풗{jKbOB}(âOynmwF[YV^RZ1>Z\m8T!i?Au`ײdNt@pn "xajTg /_M#uT)F̝(!w6L) iW`LǛӭZ pJYB( v1ٷLVlCqاLţ@&ഔ䒚iSYqgLƔ\nLݪ5O IGw<CPTdZ\]Uo&?cpVS*P;&a"3BգCfP;)Xl~P!{iEx&}7CeS<2L"`#bs6AH+r[H'YZ}fs[ln 5 woCH'4HC[ԶaRDd-S|K/n1D6s 6}ˍX0?29ݩǰ ~ -rO0ai&Ό+.^$2p=_5I%_hUo&ۢhV#ئSFѵ!$(t(h^7 So4.lsX9nI՝uj%olꏭ6L_%[pϗEW:n`{y>@6QNˆ?֥4_Wc3t3b>>6({;~]V@Mv(jW4MyMy _[-W'MK3w kKFc pUzAyl@vnz_BBzԑo 3U#e⮉ԩ"W½˹[eKR*eoϻ^h&ε|zIxooOG޼Ssl {ѓ>b'gSQ@tW.08xZ   .)޴7 jͥm;]s";^5ohtŋYm3W@iD= ESt:ZXp`Bw 3+w0Xݮ]Ol4I -E/+GSIS j32zEM|02ڧt]"u&![4 oO})\_G3+= *`[6xH=taVdʘ7@-?HA"6@>654]sbՔTٵB]Sa5CױS=j&+^S7<(,3 %L;ۘ#ST Z7J%q" Xg݇7耺ϐ-McRo*c&b"C[B&Vyf8Լ4cF&K`/U=Y-TKUPKh}Fl nD;2|o-蹖Jл^.~J=Zuvv4bW߽A,ky ZwMn"k g#lSJpI UR㎁ Y,{1P`#HZObhIXo5DGrw9>S*CV;RA4OpeLAⓏAͦY]㰪I*gHPp}STT6^}]d?ĐDWr\z'X, )A|$VW6֞Y2]zLgsdrQ?Q̯`d+u,(lƊ<1@E=vY39?3e-f5\rQ,-'vU8)WbnB7G|R|oCAgDƛ1rکR^ʬC%,պezt,O)Frѐ?h,^s<ߵg][%47bw&* vbRLJkR,?qMz`h P_۱?=>CTX(DYҍV,lTWw̛d_FdnxKW.9hv?+#b;TO>Jo<X.D>sVߟ8aQ*ȩaI)*~E,[!F"]~Nnds4"O">TO_&edrDȀ: k|0-3!"񭭹-K-##9yZ$>n|u=s0{NS5HtTJ4{8~ }M'H)g(IQD1^I=)̓=Ni:ۑ mI~jB9dT~,1T3x4#YO%KCjաb~|!23$-̋ǟf}< oQy`&6a<'N`߬^]kZJËhU_v7aRVLr l3 ebLT?k=| gYFVd!q?ϓq`iOUWk,i$@2ɦ)0 C>o%[wb B0/ 0?KXV |l:epNAX3$ɰːOGK6oԪLwN"CzR{..kN)6!88u,Qm~TfH{eI HKfOƤiWNML Tn[xZT9\s.g<1 >2ݳ·m rlp䦌^Dɷ+Gk(({@{;ÒPϗ{o}hJ!ceSǿwDz_ _5 OԹFxjUgަF[\,ñ ތ 7d3WN"ˆ&p␇MiV6aaLj3}t?$w )e)N$>3^S|:oh6h v)b琓.rIț(^C F3֍W܇<%G6JeD,Pw?cg.\ʁ3BEt|3<Hn]ai/ʯAWUw*W|ۙ<lhs"TwLRBbm@ieSՙtP9iMGJlZMOW`w$K_&LE{ klĿ,5H<<t|&X]vα j6/CljďNcmJT0ê%+i|Cˠ,-^+mErP  UsT?Fr,8o7/DB]>QSMd-N[OmA]v ぴ)<ډn<{#86P=pX+Y+h4m/PN[ڨ|(o|f8R(}4K5_ːHP)SIFGiѿAx?~G"Z2[ΕZ^$JgSjW\Aew|t$U qϖ#,5h 퉘 gՃ䣮*WorމFqRvd \ݿħH?$;H4)PrA3sJlK$FL-W*-z7+lPC,ִ:l9N| w9,gsw.O,r4ŻlOڐ7` J%&7QP %g0ūI"zld21|,T+ANR׸}.hҰ ZFvD0Y6͉BV?(w;ճLQU!!&,1NI[b:/aJ\ݘ)@X[Z)띞UO<,u4 ΗxzŤtɟnrqP툥k:xKwg}wTm'>y>elNQ+ R7ˬ]s3>=-L!ƌ2ؾvG`IX2QљLyA'Q]N3rs)GNVՎ[ X+ЛIJ ^. cGC4f4F_5żfZh?p4lG61!of gN<܀t I܇|>duo%eyI=`W(6{fSUbqĕsY~J`07ۓhY7%#Cc>chX2Lìr }wql$JN=Jzx#lXVWxTDCV>?9Ipl*HRrɅj#սpԽ^0lK5y jFδMv*HXΖ6A,ӥp9narI&4~[=,05k1p 'kW?3TWԸPCح$|88 HvJk1bᕠ !AĮ8{|l]:,D(`JOg+2s!\z^QcqsyZ nRiCӒ] +G|]l`Qyv/!?!my[: gr2#0 RLb3ϧ';=?&Wk[ 8go@c?.庵RhDr)^ 5qY:}6R`xJOIe?D``. ޸zS/cFv{3jxOe 4$'-8}ZwZ}NGWNlBR2^!$atozOҬE;Oj3ѡo 2|ٝzRFKV AOy ؉~x BfqSP_XAE1j>܀XkJ9ܙcq5;Ig;O>eRd= 94t%4ߐga|[&lx42j8lcWy2bY0et"" -7 08iN0'F,œb~X;™Rz#Vsno}n-5ri}H_nc)ACi޺QWI:lC? 8ezu:Agd$\ )U IHkIl<5:2-:"̘0C 7!+_H> YL걬#Gqmج3@yw }ȋ֋8!|EwKAQXimVn)_0B0d>fvP_uڵ֫068=,nmoO?-cϷw! f2Ewo߷1OgaZ+ȐwE)) ]8 "ۨʜY<3g‚( NbݣNQ(q%П xƺ17)j af:YI9OezCo4BgvCÏa£2z`4Ӌj~0LJӭ˻ tZ5 fC`h j\/A+ `g~k-,2HZCROJ_| Ҷ){f/^3tT ¼ĶlDX7ozMzӭ"rfU^qÇ",C\Y: &PIxW }ޭ'Z.wXPz.JX b^cI=|M\Cg+Rf'FP`4Qb/aK^|Eto20ҏtP4khPLxd(I֫X yƲ:H=[Bw]Jm_u22g7SD9-Z%PyV-" 0M1A[qR>d]d6duT]?3gܝ,  Ŀlqn2d pO|[)3\{TS!9\ Ko'sīp %Csɻܑi^ q-倪M .&% {޸u[3>kcs4 5{v!`XkoL9N:W˲"s ݽ,[=p֪[ۓ}b塯IdGvl0FOhKAԌ []3<5hCkG⸤%֠BJx4*rDBB JAe z7؇/Il鸵@bvO1UD9-FXIE glPoC'ӋI8d=F-TsOR,`SQI`mCe(\$!d;gD~Y 5JH-&%$ ڒ|%A\?>ӕP.y\MǷ,`t_7 ELJ%dP76mf$iZ?)k!x\e; Ժ*`N=c5 =5Obs6O#;zUz' iw@ r1'@IRt1Y$G 7NUuCpL3a@p,l*:,V0*%s'&n,A6L@h?-$N(=&8mhKJ54HC:ftjs 0|:vHj=r d6_r|c?"G3X6H-;5JN>{ 9mj&~FIZ>3Wtz3[ HEΊ)+M'{Ivhh>h8E'y>-fY5 :( tnk6^`$2C;OG>`'PVΦrsP!}|GܕRr?5,&Y*$+zF܁>0p#KLEԃį5Ӭs/ˉ%`lu e NVr@3rH$RtF=PyXca>LmՆU\m. ܅d?ay^q:$Uyp6:~_EQ{m?sg1$"CF r;{Ģ@2_)Tyl\:5BvPFx PH^Xb3HV5,lݕv\Zޗ@Jnb rʋ#EB%o˝JXhy/D'qbOVDl/ ܯ&ptW0h0{X߯lj5d}1C~e̐^dN%~LλH4~{9 4JU,%vf6uNd}D 5YA'$ONb}v'Urّ~n90|cm]dxmuLݶ7ܮ"fQZʲ1k^oAxA۲,֭[ <)m˪ ;Rw ~ Ѣ5W %7] 2&-Z 26+p}"+%GP;.qMe0_N&xd=d 2=9)CZGg2|AM~v}J79bPLw$ugѬM>){EtR냢d~sII["uo_g%6~ʑ~dL-_Vt h~ w溸ꨈl|'7gԞ߾> j]@EiV3=#$A.7)aHB~I!e0V0`1}p:{wraCnY:>!Q4X_!`s\y6u@#awY\V:uXWW<TkÆ<~>ys˳ܤ'#}3Oc0Edw 8]TΑLd շD'sS|cF}`j%}ߚ4չ]Ɣ!&ֹFgxO:4)s:t8_BD&'H3GW KJ}x P3F12ݫ۝B3(AրL%kO XXY\?joۭЧePb'CtY6;Nv'^=>u8[]ROl^t\i.o%Vz_o<{_Inm8sh8,%ؕ_/Stƾ]z_ YxTh3Us񿔱-Eu 1ր_@-z-VTSeT!' $1-~ GĤY"Xv,MxxaM7.ĦjD p4+tDF!ys(a˽՗Mڽ Y' `:Ue ot$>] l.K-~\7`M"eܖ*Yו}ɪopn %\y(\RҐ% /z շ:́6&{vafOG 2Y-j)E3F֟'K53:B/ZRrvV ?jI0wvMr_L+=]Bݎ0x`AlLBfӋ^:84rs#:Hk+1[jE//)7[~h^$n\ Zm*jPI|Ms ñG>*>C26|/5΃&^T#Lkl#:C`yxigG]EnD }Mp-F< d\K(y,]dP|;5<{ ¹:[חQ0^[KB`xRO J%BYrb#Դ|""h@P.v\ Χo A2x#ejD+LۍVj@&Lm<1B,d wnaV&6`vXPÈ)~/gUU*:alXxvA:L^nH\L/w಴#1(Q.)TiwonWS`6\hMZA6 36w蓊|]M< M/Qp RC7H+`TfMB.2lI~tJ1b`9< {HBĢUN$MZ5xai- >Og9ɂo%ɝ*t`7٣*%>XvM~mRKzH U(:L WEDddx?ұyr `JmqYl{H@ &? ..w*n+JStOj^sgٯ:ٴC|TRt;qBuAL(OyO+iպWqenv̬.H$jlInDƆRu񱄵3"%_ם*L"`-v@}E<[wTśםwitBGsRcX1o :] K x sQha`Z1l73wxHߤhDzc+X{gђthC $mq:[\;u{'[m+re"Is|ʁziK. ]y~&K,-4MBWǵ"6Vۻ߀w2I1)DJ=%ɘj3 NKĽ{^05|Mu xvb 8z9gncTjMHO}xoOh-:rDcJц<-xLwMUu=&ZP\<{c\FGqfVIv3􁬽)=[]H.1!FRbE{(fq=*Nj ҬkR;=ro*KJN m2y]cl߾o[P.{k얡_cYq %M7tUtara#8v'Y}.˒DHLMBȢ5*л 5:'9wZlʽd1O@;6h,c'Ff <&2#e\ _Q55nFb:ZQPzʳ;cO׾^`X%<^C`@44 6wP7PskJ|bcHP)5y#Ϧ4YtK1E `ϊ>>"H3)m}O$k> =[-.]X)u:]JGL'*sx7/y% 33ܮGw=x!|?.`ky_'}$ǁM ZލЋ}Ib$Vu]%&i?СȎ|ɢ=-g21\"0V;!냓/ f2#.nxu2VJnbTzO7_y$hܘ_~V\]v|K5n$X?t8p{< +0Z ʤ!H_N9H4,˧5ˤScoٵL0yg6:}p9[a<_3jLf>KʍJ1בW|ޕNZ闹q~B,I\~܇;Qt\Cߺ;r0k@lG֊(pu?sHvQi{kR1. H N94 5j/#-A,ZչA3 [^ !*N]zdE#cZI4^)A$:/BdK唃Rѻ^HX@N+k 튍iO'NBMy WuL; d.aO>86IKG 0poe6/;q>vg4l#E2Gkt'|jo$ <7сG!%YGkknp=P?Z 7jFc#}3s봄kYp& fÝ sa6!znbw7p1ZuETVCv'a4WNkstF8eR}OST痿Bemr(KuL/Lhɒ=j$?9 4`q,j0x,ُy@z椄1~ `y$5(HB:!H"imN6,<ؗriPu&T)}鷦K)wV5E*Ix89{%jRRrn^dJWEx& 2JEW xMX=ycNa&EɈEwe{;:ED~&Y| 1Fa4WnSZpwJtme1B2SGXޙaki[)2{%}  Qm)<WhAF5QR u`6C:)D[|Ao˷rNbB\8Fte!ŘpJہg1sAQܩzD&ɮ/a* ,3!*v[`soƫc4 )/Q[[^@">.D"L]QIuDzE\gƸI1UIkAL2K4g`q?4L y$ "l?}}D9!6?ljMgoSSEՁo} uHp.͋¨#$ZETcKLf> P6i9 ا_UBaghFDhF]a1O؊wVoiwW#YӞ^m8vՏΠx_!"(&XbX>ֱɮ8Ǎ B]f^HH\Bqw ʕC(>9#V:)~!ZwvUY~Ŵ []#:Ep!X:郘UG m|nKx:Nv.&-61VAR5Ԛb5kaiX[#쉏l7z6NkӅzW~n,b`>L[jaݪ+q0lʁ7*'ik[r.ETg(Lp~.jTk,ՒM Ҵȵ6PY=bZMb XhieRqSta5sĹjK|+1r~׀CU{蝵ؙ~'^۵4iOy@ۊ!Dߙ˱mMD+gB !>{Xhk5=)H4~!*w*Ҿ>j. &#N8fT3֧ADڪXz#s*%Y4nq$S4)y'FC'b40 PdYK^xFvvzfPa&Fѕ}-m2m{,CSkjni~t F?cuÌF틏.ׯeO r8JϞ:Sh,*JfaXcWNE${:蟌gf1c,nSAUZTu 0L(`moYHe*\u(lnfyV|Y>iH$#H9FoI-{Yvxdq#t$ɌOS e<ϡvmrq_Rᨃ` r 8Cmg"I׷G3@q'$YEV3xSӝI;ZV ZB7}J /Cfa_PQD@ڹm\:ď$(KYawBT&'WU4ބN';&cF r>dtF >^Goj~8I׃,Cc̉Gs͂q. 0uO=(2 '߅m0A9XQjC9K#.GQ}.~DgJ p?7vz8 mY־i-T"Tɍ܌:s٬&HˠgS~֠"mP+c>Y[P?] j -|эkIRЏGJR,F<.Z "&a(~R'-3~,w5p>\ FO(ͣ3T^B$8oe=8uFd.=뷒Wtͳ^"4=m1h5!SUF$4 6vym)&flsʔn.Yw |߭%74jNΪ7_`ؕ t z9UgP3bpH>f ֔aaqC"Ⱦ]Li23Q+nyKMrڏJʼnxF5\+i 06N&iTs4f0wyHR )%{U}Y4w," Jp*d/`b/X>]`V1tk62X8RQr)0#ՒUfyj3 aQ\jRl!EAwc_P-?4|jX3t&].}\vЩXIUtI-JY[%;~fa ^,$[S^}/ebe"g!sF'|Rc%VY'c N <d04|/޴LᳱV;uâ+K4v,!Ol{Y G͘<- zY}bpGBuhIF>0Y~3RiPoeAWdN ˆjŜ*b\&(FEV1 WD dH c0nC0&R->Rys {p<ɕu\ }Ev\ [[T9PZ/E.|&%ᖵl*A(b 67#HW!l E0 ) vnF~^D~h<]]a @ 9R{CC_PvKԭJ+WNg6FPD%1aĆ8h|bN*YpL7Wc"7 1TveoV%[Xzlz筚׸A# ,o.BCpLew4?qN4F9V50-0ر ʅxҮ- v{1x$0ꍯVV!#o4&gZ#b].\~y3x.KwD f G9!ht.,"AH pOPw4`D4a]7P+@^wBVTx&?Ӡ=}ǤDAiT+8 X\(h8ЌjʼnY=g=3)R=[@-ϳ:?ޤ,z;"bOo KzsG;T%l" 5ΉBS`|udK<,Ҡm\pD*;M8X/,A^lTg0Dc#)اNx ̝VW~ɘ“ &6kD 1 E`;U'1aَ*nY W~M ?lt_8aS2}q#ČS`ktkX1]_–tz[?_bmVM>Aa@ml>atxr##C9 Va 5pH{:}kWȊͶ]e/hZGLС(8&B4_]N^/3:agJBd,Ox7KVv咉*:c JB57H nfd+:$Mu`'rU(eϱ~f}?/ k?EFݣ,)R5֡5SФp4|`eDG`¥3q&9!+~J`KZ{_y.MP$!'o b< WRCZQH_J&|s浢.T8Di.xvz9W:8Erp#ȧ_`z(1tTΔ'@ǩNZĢ=2,B`XZ%p+M~^ l~übzY $E%`Q>eړhnZ*{4J,}O}ȭv2? p^n $7)6_ItBQMū-+yGBGSsTw=ܢ֎o5%W~ F "n71e}@ÅY3[~'}w"F_]yh|h%:IF(Uj˜ DŽZ|hhazwWDaұqnP+5M~Lӑdh[]?ZM:(V=g0ؿIitҀtey撆`uʾvyB͓!&Aڬe kHҘܴO /#lh'"#:sO܆)(WR,{leEȚJx-տE]5z:aVy( G7OR\bn+W% #U9p8uV<47겡=]p??]mTx?^ =Boi:r!ge5)%ӷ iwMse(1qmcqc1A_*]Jgf H=Xt&A}\)WBU3V6]VZI 1C5M&:JCpq 2,6j\ fIs2#;E̒F |SJMfPฏNQ.e SDS`pY2$pA5S.%zG8F vv9DGAD9^!;q'޵9 +47kSFN_ ө^C "r>_ؽ],]ybIG`D> 'af?B&v#]#]^%"ch^֣.Ұ6|\RM~ PPv]uq^"2t8}GiU8|xtئ`;#B'֑~1[g&vx_;ajCe\7Q]yT#t߫YGƮ3kg6h"2;B8"#&R8xk@ڀr,I8TuͫV&Ipxl+ek|N ]D\=jJ_E8qK2L5Q W흶mA@;9v̇Kf쾌nID@lν `,-fL}**TXØx|@[Uq+ʪywrP\eJ4iV+ G󧆺zwp?bf'={ﴺ 'VEэ7ѝ+-h31>*(BxzpSr#ԝm'/IF4 jяRUf'xbK%Ltc~KϺ,&ԩɟ8C Đ/G-2$]t8(L@f`}LwSݤnH;{6?=,`RA`|:%O ,+Ǩo0-Jڑ6H;k4*xIZ-8?QLndg&:<>]!E ˸?ݎe݉Ξ]ַ/nf-1em$d%VTWOM^H4᲏24ye "Jr>n;oj-È>ȯג8W N2|>D#"̒ߡ$zHҼòYsq&U-FL(5=0K>64 Ȕ_k(+yV >M_bo )Qz.՘rujVPZ`4u森q;H^.ufVqƗys{wNB`S#"YRbM.iw7N2F$:Sa tudf4JfT9S[|ieiԅfUuCP qagȖL3EY2;WPDdn𧓬/MϿ\#m%ΝYY1뙈c?kZ]TrfƮk^IkħJZ::ȸnM90ESf:OyY>iKn] 7$@'Qs?Y{1IzQ[M-Hn]o q-=0: +Bi/@W`j\)XVI#{3=Vx;rb?0B\~[lc) ~hܝȎ7E2>a-H8:%o)xZـ* e[O_ʉp%ZyDB.'ˑ|;%]{%(r~+o ?sG]jswpEQsb5nMP`Ⱥɚİ2QS(gӚsz4i\bx93:FYsFXh[VoEIC=1oN[ Cs3[e-eΧMx'(űN*}T D5hc5Uc!j-?OXcI]TI[CK[Sb]q Џoj͇LT&v\ OԖłqOF{D;f'?:z&WUIрPWlGpް5f'B{EmˎM耇8ޚlfH~W x3tp?1bF΀Fym#%;-/ .ٳ8"4N^(BJ(`L:Ռlޠ<n:.i+.WIUEϞB9)!7{f7x([sk/Wү4>uBp +UHLӤ!?2d3n,J=}V ,P7Qsp 9L{*E[M1Qo T̅ ؔBnTmP`1d[)tN%LgiW.fshf̑x|1\鶢=O^OVݮ COIMX,xy!f{4JX{iP$m Q'-.^@`SCp P^#'-:I6pm4o9@@W~k)luZCBE~aRMX2W6gt 1#?x͹Е 9糌~\^\zB?w;tSm&esx4CLO+zY-hBvV_fr5C~sx/mmq;ckh:e}/)F;A/';GR !Pը}H\jі(hcf{Ԝ4Etg#TabM旇V_1$UY4y[̈́^? I"a%T`ISbqې(>]8'SaSB]kT\CM! uLK`a5\ӫ ~*%6u VH-l&Fby.P8waTOQ o[{q_b|Isaw"2u) >nB~M*mdxթg⤮uNk\H Մ B|FJ s)OI^h LԿNU{FJQQ/ >`SU"[BP)s?qVRr!iJ"ؓMU0 &A,d{EJG+#.Xcvnq孲GMjl}rC>#"*69)NF F3|VOMQP;b\ћ|-hiTѓe"˂. |0Mp&E9C.d~RN#Y7lc֒sVp)j=Դб|JȺJK{_! ES +}G]|+[cgJ=~ 58K d[{mq<.se1tB{f_ M*\ap}pP>#?)s9ģ=/7\Ip\6dΘ(  d/n+ek  :+a7ێƺim\吤"EnZ|Xa&UhƲ8R4Bv/6(OB@u3P-22h^wҔO_Kl đEIj"(yS%W1v[QqK_K"Xܛȍcн; HɖFhefc}ө8PE!%>LdaRrM(N-b@+J_)TbR%GnF 㻽?eL =v L{cU7kʌCmCʧNtU|3>yn^8!K!M!|oFv|e*cO;;"n"325vL4BSiAFU+Hdճ&% l>3BPȮNAU7zeDa#(J\%d]P(D"2fpWS}ʲ`6IE{zVy \.y)S?c_ħz;X(gp*&@jOAmd;L< 2fֳK0ڀ&SsFlnq$sۚzRYDsᖤ멼x*OȈ. Uk`_dq!LžǪ^+貓 aҳDX<,8ۛX\ mqI29TO먰TG <2Oɇ  ds)kJA~_ft~@]8K9RCEW `eo׳R)zzY'פYAj'(BBcy߉͵%kKu8uГY/[o ;ťYzU=aڛx@CW {=ϱϜͨvqtäeNԥZgYq(u+U1 4%5Q_E7&ķ8.Ξ?rJQcS<04D^y(4!:Đ7Ƨ&NY>> q7KPdByzy_(PA 3 Wlv#,H: "T@xfIʗ<$i\_B:7h(ڙѝf2?FRI",3&|Et|Cpt)P#ْ,udib&Bه-R ?"d1)iu~LhW+x~I[. `BaUApdzOF02SI)YՕ$u!)^}$cu;RС!:"a=lmY~B^=yNU =L`Jg'QHXr)ݵZ3nJl',QEKL'LQIAbBՖQe4Ϊ(63ψ3޲{A!m]P㹫u98*jgdxI] bT,=78b:> in$ZjdV/oR8:,$z! ^Wz#nP\{oegHh6s)k}B-SX:HWФnA)nUrFRFk> o`>Wg:^b$Xbv] Acbץi:3ٹ0H LK5ʠZWSZ2p,ežDC]IğIFK[SͰ $.Ί j!Z(s4x_b@d@s,u`gh|R .,VJ!E[b/ܽ2O5)Xǭ0`*.ߵ$5+ע9{k6B:o crZɤCvB|g.ﻥgcǃaGǞUC )5f)oX8o{OWqrS-+]Rao;ʘxt:pCodcS~xA/<7L7~lZ=yh.oN@Е=&n55@Y]ñwa+v``]L( ]o& A~)?RgNjm1hv~1)ʚ)ȉ#/ITn-5lᠢ;ʆ;O/Ոf.Ц׶']WFM$ "cD_}ʜ~bNM{r@y+x$< ZHV66+tJH2H !v}$gr0ᄿKfHinp1&_[=vwբRzaȼنߚ[@4k튻5DZMu]Ʊ?f{|0vӰ}Sl\WʵTwl\eK7ac\>y@Py dѨa{}ȣ1 %T$a~θ.?wҞAG'W0/")pTm4JRG?k&`q<ԏA^nhmn1T)X\pH-wDcW5 `ɉDEӟEtv֓a5.WTܽdQC=NqP=ePF&"͹vjgr.חRk,yb~'1B8Ƙl;ʢxMg[!C'1P&;6O4%51QÍOG;bwf:-QSxigʟ&tkSɖk(=짓@  RvC)QQ]n˞r^# o

| _j,uy'œaΉ.ꡋ;~L[M?+,NdBF|Ĝ#`O.jn9ϐz;w_]*SWklBKt/Kl+w2%ޅ/o@xk9UuG7,3iut{,2瞍JkeU=mhA&)xL=|r0S?{ľ3mkav[p݇iRi }ojW>#Βǣ?(%V&\,Wf:v\v= G ~]ޕ_ɐ=б,czp5v2؂Uw"l>}q뮑r UwaEut:PN/;y)ݓrkY؎Wnnf:ՆQDR٩vhtvLk# SkY 1G0)ڀ Po"h`jzzD)HO3]$(657̈N%D|"l5fl8ia'D?{&lbq9>T#,A.0yrzP4ihjQ$ϕs5rÿ95Bc ,cػb&1,ǚ_'2̚]$Kj(ASġ_8[by^ SB攚QCL|_5D%S {CmxPwHnU51G^q"QGoF>V|03ۖ+Rf7|h<5&".lVSS+V>Bd%a  ke J`c ¿ Bj7XH7{G`JV)T]vngD4#Z"l>x9~5! 1kɤ2?9Jr Sj)m7N[r(b/}!FSuI]D\+\ Vd?W{[q%7KQZB?'4WԶf'J' =7=ZVsCZ+MţJ{3N"_JTګ2Sly%lrwWf:p. P9T"Gd H^^ˈ??ϥ6!ݟ)Jn&[LAŇ2nBw'}PoM;+Q#^gM"ٌeHOk~WmUҼ"^i i=*V:FE/s/9J19F9Ⱥr5 kU8$4m%\F~gʻɜcFE=Vw:II4Ś~^ݏ,?%y8\4D_s@ ᭒?!ؕ^KmxǼo%5#Z)Aq+*:!V/\.USkbWN𾍡J<.ykMKyYbiM_wZ(MS^ޟG*,0S2i@g/=2QBA~,ߌ/"$A,s)b _ ۛu >T,ȫ1B>LjQQ2If2Y CWc*DG!Vk1sρٰOYwXMa_#o l|.:H.u=0* G⪔)vաBQܢY[JB+ȘWxă!jd"[N]4}0Tb`*+(>Dt? #mOS2hI,DN{JʑiŞ]-:`^t<ܺ!f֏#eop ~{iwY4yVdlҋ9yH3Içڗ GM]wn"!;Ϸťz *1Rd>}(xmX "ҤҚ ԛa1;`1jd" Q 8[tb+>MYySJޖ 6bBi{@\<63T# ʡ.RTb,e'(OcTRR_ɪipIxuŁp?W\&F@ܖE!?ʳ5O${!*@!RQ})?ra$~jM2Q1'*.I6udVm2ZhîB󽏖7L/vNh@;ѣC{Z1/P}sHځ3B\5! 7 Llw(aYдZmЈ/P;#u䂖 dfw=J0FFB츅Xl%/KUw΁GD dBb!BEYOJwCjvS$T]v70b(_]y[azn{*݃Ж%0:Ç\,x'-O{`qFVh g[zmϽ'S])ipTP1/tuj cs#Pe@G죷!ﻹeE:QKXvfBHYh>S¿+lc4l~B`+KP_aJXHZt8.R5sO /3 sƇ>ๅI#MAb>g3 T|nզb0 YZ07070100000463000081a40000000000000000000000016851c97a0002134c000000000000000000000000000000000000004d00000000./lib/modules/6.14.8-400.asahi.el9.aarch64+16k/partner/net/rxrpc/rxrpc.ko.xz7zXZi"6!p]?Eh=ڜͩc l?P[f-+b۹~p"hXY hY ܈&q.f)`# g$rN2Eh+v#p"Y;Hǜ/=ùů91p8 2p#efR9%hq'C*kݧ!ikDpybBJjw5`mݖe/5|s< &d+FsY~,u3&Rẽ;!N*omwPR qHd4$wd,ဌcJt!}ˮyP=ZnUS {6/\ug1gu-$Wjzj=.7LlN5Z&v-Oْu@}璕u2 x{'B35E})jXKIE0O2%KyilHׄPd?~t8" !5E6_f5[E;~d=g#}b_sDF(no\^fԉ׌HNی׷ iv\9}ƚ e!8qH|Cjͤ<,/mc.! ron:bpz#G_3zb]΢[ƅ&I (5}mu/va) RI-g4֜<lIm4J ÃQ?:u^@?FCla& ~ 腿7W4Qʙ#jE~V,#F/:qIX]MAM)9-G\y -bPxH+ a jY_>jdd1+CQ}H*6K>\lQnB3PU;,ݒOlÞF@Wot&;y\A]|6L{"t[d6z2zfN,RӍaӶb"cS4'ZK g"+7o7ugnG  (!kҊ4 E,Vu_#«MZ+ YTd1#A0IQR}uݸA?z&נ_j{Qۅ1FsM&r"2}+ߜF?.SwgOa)%ulXj@nD{8xiȅfl|К($6@{&2qqm< 8!gyVd/qѡLVznK=]l"[j0(3P3_c\E#xŽ'^6> KMŨ9]#0<vcܯYt9VF "ǭW 0Kc coωv曖jPj,TmF3e؝vb9Ls`kGOEeGYX1S9)L  fWQc. #EUx+t\U1W.ާ6%CBM)pբnuj7p#1ع?zD`,K/ʮ|ېOBE(]`JMk';ף>uv@঻CGD|\{.ŃSF?<>S0u;_62$!VY[Nh׬ eźxIԺlb]'[sgv9ֿpp`js+I/9 k@1K*##W Ukpo5(Z(e.Hݦ؄g+eѢ x1&Pr{C/qMbWl- \ԚÊ5@>$[ u/eUI@…ܽ~ Alm;cmնL>R\TH=bЈ]] kW>T.̣sH ,( jSyg` }Pvā#'#n1H([e*X- 7+d41~虅/_ڭ c/?ŵqK ŴZj1p,\&@a`JmKJGW]D֌T$l > |@yjA6CYH6hфX~m,|wU"MHHgF\٣khPsvPZ] .N>o 0gze&vL(;w>XAIfSFeV0b%zƚg4}+4rL$D&r39X)HQ:ͩ욭Ӥn:mx7G(W*"nX`ã uO(8토#V2h5 kgT(UMFiOzJ!=Zjf>~HZv۰% r':AWiY:T 'N킳,Z>d<) %q/Rc W{>pUq AxX6HAY~[D#o"ixZԽgJa]5U7oSo^5`'kp!p"e4&<4PylmТ8}w.][%las<?\3G"Ss$< Ȣq‰Qd0(*5z!iӇH1(+S<-?Rb`D,4׮ҥ/bK5wY91:iPƒ8֛~PCy_ θQp$$jTxtTu`anR&$iSyJ_nK:<r5w#' u7U p:uCP4͉E3mq:|1t5#:4M߼}U_XA 9KaG ܤ Gu'nroz(r{5?f@`9%x_NEԮwc!9MCm ГmF&'t/fbRAkZ1< E,][iɗ#(ӥ @? ,.1}& 8Pbp언P?F}MLf3 šG,G2)&TyS7mQ@3 AgK))q }969vl@ =3PNx!/O]#5QF42v(6Ɣuڃ,G)vԆISٯJB ;`e_7uFً[X~|E7%[;aWH1;9vz*~ *0~H|pD Z׆_Yzx_#pL\Wv(*h㰦|0h_|6p@.o q5̱Dz,恫({$dR/C;# M%6,}z 2ݶ6۫\i9$@k2G:l@v> Q$ y¾UZǤ2r%%&E@ysQEFL@qOzo>vC:r^#=_k姣jd7"kdט D 7wǂ GW*vcp|-طէґR2#eP%^BAW* ~+}Pd…`=o2_"^vt㎛cV\_MSr \ֵXV ٫vvp`+ ڑ^AV~6w\rSJT~[W.tBoT26;veC?6UP;9c}`ҬyP6(- S_ՂFAv鷟-Od"O:ܘC c63-^f;M敝>I]"Iۃ0[<#fY' %/ʦ?p~*XRH-y2G6z>Ydvr{+umݗ?W+kݽ"b;G*k՘e6Ύ,}ۭ 4˲LΫeG97-4/i2( eHs>JSf}K {jU=8EJ@jnh,C8hġd&]f.cq  uV!LJu^9Y#+zO7zqX\~J@kT+#|9؉%KhKg N&&/3#M&Q1LzX©];,')-,*>!IKV5X!l &d^mtJr0B,iy7M3Ks5(_ZEXhZ _y&׎ NVNF{[ [^#4JYx5gT1`jQ(| ;-%JvRNqȪ\Y,qrq!Llj6cf6i03!**; 5Wc%#} 䄹65Xyװ8iZlr4'BSbW+<>mi<2ta!'bSb|(ʓ-v#JG KaB.\2SE3.z C=4>΍ ]t<1Պb˂RE.IB?T1Rwu;2K]3kWvRd8BQ7qNZ|*6BkRun"l$(u 1agS{uo- Ɔ*>m6\ x/b@2EwKh̩^ϊ}P@eo>1ILb?['Y&yGD)5Q N/dGa!Uf''7YeC jYLjILU>y4^p(JZ:ϵn>a[&& 5I^]Xdt4[w2Wr  {#}:osm;-D!owٖXM&|Iklѓ`rzJ{:/ߤ m$y%FОZWf3{jXuCZ-8$*dI0 Iڵ/4ݻ)cvw4[?zJSWcT T2Ğ T]e+ JU03UsK 6Аݨ8b)H;cCwҞ)'3mʹEQH[ ta6$r"_*% kna۞ˎ]uSC_gH)GٵaIE2؆xCxPW\^K]w2/i1.R[Oˠp%oHB3Mo %7gwK9ږ(plHwc8 FNH8DeEQ$A0\lao#~Ѝ.2VHB<*^ɼQ|8łfm03'om&2a/]̹$!@hU5z x[D)R="5ߓB'SsWFX>'_AI(`CMZO9??@Ļ֪VI~V?L`PB1 $-fNKO9s /NE0Cb˾C z&vl;fƒZX*wλ>5˫"6'׫HM&P<"~rJ~H7Y޼c1z(o^2~L(M/ ̀W}ƝvE]?H G~[sXQ%Z6_y|#{ut <L@WwifCGۤ:l+oi2ݤcدऌJPHUVmԍe|RUafc;.^ 1jq[v6U{yki \679,y7 C=A>hp$8#y߰ü}̞EW@!l5 }޶, ?( J0]%Үʸ}1LUwHIY$AȺ{to%a(3Im {>#yΙAi E|AGtVei aek:D;e˸Ccs"M~^O6򲟭۔m,wQ5[w%v,H,6-6BbYC)7>oQXӨw~U#4pHm4i[ApP(Ոg'pc8k9+h@A!Mպ5^6J=7|Ha`|iE)n|Wp)c{}20]q8ޡ$TFĜv/ WKQ3(G[I`u0X}hz.:&F.95aT"0>AWr";r*ZXbsX$|ۇHhHÕ[ظ17c6{H"l6ArOD+P%T)>5\Kgfun/%K"ݎ&塑n,Oߦ-VKz&` !1E RJ&xAGujŊVhD@j{ [t ڈCG8əq Ih_k͠*~,Bz/Doܿ^qi:Cj\ YZy>I=qu˃"`As:{T)@o6ATKΓ0Z3>IJsKËM8mŹwxh_wи,uA-bcPŦ= cF2UhGdDxHwe1j zߚWĎC^dECd -Of#(~¶xGsJl3wUZD_8|mXU܎3^^mJEx/C=rFwIlJb!ʲ bh!=W̹nt31TQK7=T1+[B!2aj 659R_7J]waAsaNk61ګ^t͆(ƒƣǭ Mu tAI  YzKadhי?;F‚آbr0^o G =`)d'7R矌EQ!(H&s6'ińZxp$][z rq}Ն+NZIi B [Fj ra>Ɗ8 ;pN gӑBH&B #v_96l5Q3'*=X'phVRQ3xG%G6u&6:5sFD/q#G^hw?κmcי-^ 3n S_Arp*\TTsmT䦼u']89zPqkWC+Ǖ5JDI!e،A*}T\"j.*dKcM|N`~:$4QVGam6 ڳ?>Tl* 铭o4{')ہj$z@ON}n:R嫒)EGVzlPwޔtQL24,ܒS]7,QYY7&XY{F/p$zyt}Nb.4v`F<4Lx'M. Ƃ_rK~΃w{h5f#Ԃ|ZMO>jvO%B׎`ɤN>XDJƎG#l*d@~.w%Wn 8F=M|o E`'5D#И4O^0LQƦBmg[awrRoȱyZ>bH}>E] ;,5^SJYTR)PaAC.Y>TKmI!$l}ίiM;1!@k:Y;2w@Cܯб /| ߔ%hGߑ}s>:L/KiegyPuP0|=0PC4[|OB£P@/(Eo!<B 25rw4ڰ,eYQ& (IiK*ϖ_ShXK5Wgw*(+Mb~sbuwCLSol1 h3wGfxZ@=ct¯<0Hp@tI|q<5X6q_)HT& &T^g p ?!rvYv9,uIDi4!DO}r$1exw;01e3MЗaդ ;mQqGVڝVl/1XHr|8|׬n@2WlT V?о-;c~"`/-;*vTFZ iL@~BS&BDt$ofۺf2 Nd wW+)2&$>`69[^?>/ԏ2r 8Z_a!\1%0N*;>&ܭ~Xqܵ K 2Gb`qFlAL7ft(~ܓr\n3[Z)I \Lnc !lr  c! 048`ğ fId< !,e1zLFEm;w'pȁ>@UC369c]3c6q+Iܪ?0GWzy ,-0[hbk?^pHs}kug Ħ@SK6='ZoY`1uӀhVB4mZJc$f\tO:L *pJ|&ʠ-„@ֵjxԢMd.yFTP?"J(hŶx϶et2=gO5YM 4'pG=(BC1 X؆rP%'zȍ}HVla]\lYXިQ^3~4zVK(T88>3x#0Im]r!s7?:i˽IvPIz;@H?@(_rhl^tPA%?޼sx#⸲\& a"8pr<}a7:@@f iG)jw 3Hk>"1Z^*|,@_uWՋFQ>-\2뼚<Tyh=@Q̓!"Z>6'C"yGzA٦ft G2t|6]18=`ϻzLr cl Ͽo$/a낽rk{9iXxt:b(<91ȾozP#"j UvA=q~S$/_1'ى K|gJbQ\VOl)#"aZ̥9> K, Ty4ZaI0ཛྷ qE:xy?Te9` "L0 ^ǑҚ$&_}20H?feYR̷P[45=_}%c(tr * 8)ʁm k|6%+eTZgoCG -z?ǵN\ۻ!ٳdxNRq~x H '6o^t_kA› ?=vN׍ =3\N0J돩L=G\e}D @:|Jjn8ϤSL%PN>~ 3}[;Haklϻc 86nA:54~v?CwX0Lo_Ú~Cg<Բչ|]_̮){?߹uӺeE;|zd`QvT% ;BP4@L!80RΤpky~}x놫cSt/> [JpK蘰QGbMnT pA6D5`@^5$Jh)AwB:~OSriGLBPhn詔w ',7yߚ䠲9 bl K+ޠ></o?ρUE]$Sbf5>@~yjb" /1մPj:obV%&RYDR8_NڇG=:V/{1CkѺK;}-Sc BZUK2-dm{Nׂ>QUbo$$"YNwZzuy\yܘѹo>n=ˤ>@&ᕩ #  wT3ea '36ŶJm_ ZX> Q?ۋ( 'rs6˷*,FjVtSY+7we<Nׁ`Q?&G@&3bL_͢(GY [Gu[6/=%*Jޚx1N֮ol#I)ad#H|ήiO}qܯuhB8"ס;5CJ ~/%sݵAMN ǝV`gҒI]y:eOjHم`"7yԫ]gyQq*܉;(hm;96ޫ%V1 <-a7iloH_K&ch Vl^8 T\g5(ZӅQ! Fu#v}IOpA))x]ڄz07TqL9iʀp M'-Hݦ^eKt_=0r렞% ?[ʮ4ži^8g@ _k*P@J6]?M+xjljҀ&j|"}errxV 䙎(A,>rf2*؜|ª杺!ߪC/ er董+rȒ:RNp,F 3"hj VPXy@_/o7l7⋎691ilZzMz])oI7iTCؤo[4>>YgWxAy;4{tOo=>$1%:{M@,gfO|BT:=K`y*giX |;#ZХ-2#cGgXv…kȊU J ዕpmQ#{jUdܢV\dҺtf{ M[ :+loKĂkfjf9΅Q|B%q""j'+'8C$'Шz($(T1&qKmOz]6 ˛91 c%zb瞳cxd/hv6 f^})ڟ,-;j%+myX1!`Cp{^}PY>S8Tv;{{|eFic0-ZKg ʄgf5ND*3Z H_+#y*G!l{i=FwL } j+F`EyZ>j[.-M*n>vtRZveKB!(.5v7aNH.GJTl,a20دz.'?ش@6 je6'"F,j j[-wъHP%|X%ycXM}c&`DB|Rr8v/{N=sh ' OV"QSfs֠sX8JDjuvjugMg+R}j1X%(gF^]jT!gb*$O6 2{ ' Ę H?&|1#kK !]lCSq}5 6$&s~3|r`X>/qx rW接&*Ƽj-3[En12=DC<&e[R}|JWwj]OJC'wʹ(hmHǀd՜v56Q0aAlziN%%@FvCXK撋H 6>b"EӘ_1dBHGRkSV9YownnEOzƽgQtZi6mTh6[;LS *B '{V SxÍdeW>udmue]!/HM{tVd`g)sCJ)0ۯ2:IHU-p7:goH@;P;'Q&{M߱/0FDM'uL'xԀdڑSY52m4wAbD&bbxt ?zw¡i&S*(Lpr=Ekj'W?]&*s۠6DX`~̀rXaāMdoֆKqSHC/]W'$+QO{.BB,,/c²JfQ(l\ (OR?hdxWF]8ׁ# cGp؉ !&u|9*%>kQ3C"O,ϫ,+Y&)fdBO% G ds0<{M4Ŕ FϑHdze\4/i>05;b6y%̉'ܮ$“hʋOkתAmtjL"pGD<Ziq Z ^QW~` ]/}_tjNDb UߜnELgՒߍ{M59()#މ" ~إZxu41OvlgDF$\=ZS}c s-l BXe| <- GSeV,?WoZ\~-XpbY҈E*$4d/9SQEWaSgC`wy_;N9޴-Y!VnL'YPܐ9eK{0+jS%s9Z0RID>K da! Z}pLwz'TmoXN@csj*"xa7\Q㯖@LAu=-9|^gpljD]-9]-.vr&If:nI0OR^]܍`+$&a0cw 1J"#Mʝ<Ef\f:O> 4Lj2U5Q-xniS b 5VD M1C3S1[YX\|̪> Ec3mdhZ1n*0$w4gG^ls LFƟӑKEL0D jvdpg`ك wQZ#M[Ky/dF| #PT5fNs,*"0Ƈ$P(cpMa{ߏ*MYisDa!6\#&AEˆ}Zot;! oL?UJ8$JKĐ1=p:Ɇ*;,ʞ<V5v36G׿15yl[om|vy{Yp*w1𴮾V){,\j* w4#ִ;"P}+U[ȎV=~w?8;A7ς|[]098Uu2h؆+U;T&d$TD d-W8a~{#aڅB2O+3Ts` >jpH)Ksa 7x]%LJKҕ)&DA.<;eF /661TgvҵlC.#>xNkTb O+g,N6W]+6LȦZYOa1rvhrC@soGl%{CbU{U(;n*L/0(75:BA(&/Q'Br]rFA(#s,ɓ~+V: upcK@ۊ J%zXID˛6mܞ C!?/ tpW78F12YG%#!7^V^84f|.HDj @oy4.E#/FOPhavTuƀ_'e@y1?h*FEO\`΀)15<: oL}XX&ҽ3wxFmP7WAwxEHם;fG6uaV<;Ӯ.) ñ;Fo_卫&17A^ڥLQ+.)zyĆ@#nw ךGTũa FtՕ#=#:HqשU~Zu,I"َOnJ/nw~EΌ}T p{-Iy4Gh.Y\BÒ]ng] Oz3u\9#IUc}P nP~cQ>;-[Չ/. Jc~ob@;|t \!ʈFȉHK+M9s7:Ρ\~^nh;E_8_mYݴ }5yBB7gRiϐ(][Q$K7=c>1[Ζ#9|k^;ltQ ;0F,ZISSe=sz2=Z1n^'e4ޯf = _~KgHJ_Q-&5>N E1bׁ{HEs\K9TGe֡N87=G%<"w+ XCc.ea=b!^dEp=}W* eN }H&w I/j`YMd0s]ǣ&GƼn#4 CJsܱ}}oPu$+af{k)ntk|I16Pq!ע>fFC'VYދn~PEuuk94oܮt Z|ok;?rĩz=3Zg'wm MF)зP>y+ &#)KWڥlS !2ىv"Ԫ7V+hom _~uxfi.UpjmLHo5d;}$TScN*A˯ I&i-ms3q=Ai/+ φ:O6ʁ,=uof{]2Aws#'^![OڡFsKRq^18>gG^cl959 cBT62"G(qGw+(PUΖPXn|rp('pɎL#.]{a7:nU8ZLQG'@aO _\1xBhi ̫o{,7B'5A`{?k.H$8S\= ߺiKTaM 6v*wLm%p7ƍ?] bՏׄ{*qUڑPS L?)>:D[WlyfV`t,ȏzT 㙿4Y='B]9}/r)v] 1"sSJҋsLUK}}`.g0:Au95\ |tx-M܌~xy=JmlJK0>B$  FDFߪOuG|hUX &q/c[ =5"M~ p} "&^YI!Ur,oxIF qO"b4M !]k zϐ2R#!8DVېT8'S iu80:##k9D+p *M,.CN!;j`:P+t$e/UavG8^at- :  q> I#th]8VG'ю[/<\#Q7ϒz6}47e΍N'uD&&! b+t'u[)so/U&UOF3@msY QOcP1+Bz}3"Lm w4]w#_[l֚= MAn 0! s1E q#iX{&Јɰx T+q|;X{VXϐM̱'5iIrctBLgMe}΁8! kpف>_md%ػǭ>=63|k7x\R^O ,_<1y+MV&&9$&KNӜ?(d /%ւ4Ԋ_2/5l*.=}|ϷJ 2ZFQ3 b D兯ʠ ]I/LƃJfͣ!mOדhMc:WxP.ƿ+:Dqч / 3GO!$PAOnU ? Lo-ًk'%!-NjO0[2!([}mnԟ c0Um+gޝevɯLO2t^$g_n~-f[/,90!as]iTb|mx{;=|1}qy[D]2E)IE+$ ~-RR I=&ŝ5{h](,s ߷: Fv; %I L[M %k nB`$Sd"w*JCKNT,ţkedc 8k\َ}4DkFn]V@d0P0rTp;ِA*.\ʏ@x /: TNVb? 4G@[HVHaNɔ\L眤  s72G êbkR d`Wj Nvzx-fV؁gM4uF 3IOx4g]*u@sudG}YG6Su&!:sԤ:ÇE.tg"DzA*k|cl=Dٴ+f2]46yU4%"沯q:ZtBBHbd<(+WdOO98"C75bhb悺P=GwѬW.7鰩&Z8;u4]``j_F!E Sjt,܃Ⱦq!yΪYϓ齾!&qUtmeĉx {hEV1 Pԧjy׌6!{$2n`kw}yK-J*s~]smj? Np6ʻ*?ͨmMPm"1ڣitA+_LB=N躖sĔjl,+VGmz;pDMOIpxрN ʸ?tKC!aTȪ+E~_CB|@KG~fWRAxAW2.F.~&ik@#zjdY3a2L=,~d*Ң oc9lbHߚ<'2=26N ֿs3~ {p7\9Y\cŅŪ9Y qVak_ȸ)gHZ`Gcz+Eꭠ}8Rl }MY/h(q|0FAB RMhl8i-*0×KAUt<+8j* Xvi5q'D|ȮA+1԰n姊@0|6 B+sF/9C]GX!7U]+\|,-1B;@?[{*FS^oהމKViިohhKȡ)*3՘arV?#..|1x@v<ΰ۩tE02%t(>dK2,uϽpBniœ5DPmc B0ڣq)1y$! 3/v7%Ey"#~VQ $A{r`ēZ` 23nVFS^Xc%Rf0v?l%0yS!t'I4\jm`ݶQ-`1[ QEl-UN1m$ cv"DZ@6|:m%pm*{/UVqQ9ܱy9WP0Eyh=r>t5VRS`2%co~ O"_%'jWlbɲ8G~jS[E۝LS:v'T'黭YG{g#u_*nȑ,?m 핁r ]ߝOz@sE; vqb;L1ꯋpcV N\@0Y[ _3"Q(ڴfs%\b]B \ *SX.k#$}f<63xEX9>Zap'a*Pb[(`!t PJte]sE'.X|3pZi%iMP2N2QUR#׊j:,[Tg+w$u|9>A(r3}7J%Xs`F+ǝ0"6|jB pG7l+  R#Зwm|@nn/,4_&_@SUU*{a$PhHKzhď) "7mjFh3 <;]` gIKY6tݸ:A<$W"X;pHr"9h Bp~f{klN +&\ ܐ&=V2=h++j1tjZXc'H}4^k/+o"޼⭂EG.`r;WW{t+Zk+fѬHUNGfE׳u*O?&@ vȴ~@ +Eq2uT*z9L- 4!@RO}A@R c_ˀP$ }6+K8UAZ8\m+0% Dsl[d h_Œ,όn( $!L,y!].פs]H@c@%Fb(䚗%i*pRw%}GH ۻBE;8S3HW#kߩT"@wU6)‡:BvcI_a1Io٤7 0r+ujf<P2b؆ 9 _Fz\@訣1r_1.ݍnXU jpܫ1d3S1FQ(O.z2F}F iɪuXǭr0>7@"r뇒ʱf}ۮZ5"Vhl%fVc1&6!3N2Q{]e@b5v"np\`:Sق> Y̓8X?xkQyL>3 AtUjizu-D,\hDIlF?!^5PB Ih(&'Fw. ,(`V6Q4p2 6'92òWp\;pu>'؜_M2?aޕ*zv=Ċ~8'վHJG"ljrۢ]ېJYcײsQߏ@\8;:},l}#ױҩIR9e@kmZhw*?@@|e,cF ԙd–0AxQWX/bl\%xםeI(mbLv?}R^g'ގ&bt,)= C0=r^EZ7g(؝ *cȭq[,Md#Gfk&:zEQfdR,r#x[ *!eavו@3M8tM`5&L\;A{Q[}q^U) BZE-VKچ$ 1#t֨65-@zp2BԹ\yT2`lwg3lV(WJ)ҠGmmDGl 1yZi=A)3{)0,(>m˜D/0_Emifst ^k*f]Wp y?yPT-6KV@l]L0~jJm ?No 7cEjKR ωQSV#?c_t }@l5z^x 3j?7`XOmDY|FڑCneDf ܱP?]ѦZZi uLw|7ma o>l1@nl3=ΠVkodɧ?A1)sxA<͸U!sH-k kkt/ f''tsl|=S`@gx64=2,\Q^hJ=海륆 N ؔy*."qO*5(@4p oHf,iͰ7՗jxIBt_`RS ^ꝫ>Jp;~O<^FuG; 0&>.*DM]D ϰ6efrQ\ew?uCoH3A Ka׿X)7U@7}2ϻ!G#1>ڲyPʠ7}SPm$[tF7S7KmqtsʓX'"Nxiw4wt $&|\dn3ϒlfPt157@c?R sҚ+NTg?eu[ztv'׸DSaEѯDVl"`}(幸QTd5[_;ti@אz!d)Ft 8Aʬդ Ar3O B ~1I#ڄ X Y q ~#(hν|$A4Ga4ZsvKl(T?XRb톂k8簆3oˣ\)Qp0?НjUq/֐0+;XbmXφ Y29qJ[UMWC [pFٖ!n3ې(03ݯc,?jFK7vβ6imdGW3;A-2J?oFYHa9UyN=0Ub6<5#HWÑ^`{Npj~zګ}ǧ&vr+dFHCBÂǠ5[+=OEL<ĭ<a6,z `(RVnA{ΘD3rɹ=T<aPOh-B j7p.H[d t kEg,^J&Ibg.Etd;LQfϯ~Bd &)/dD_,zؖ ^2U?\h ^ V a\񷇆G5A.~%"WJF+I_5L _l#6ؾB(<֫\ T=ߢ:%[ۡ]g7CGdjzXO֌I4tRڠ ,˔ag|2~e|OX1^xC sYse>|eT$?BupJ=i'=a^ =]69@1/;YE!&V糖q@r32U[sƂL'dYS!+MRJʮ0^.@zIq $lyqXU|8α 1bAt늫,[ 03q](v=ק~x/8:nkk^Q b |Z"^i=W# m)NUM nWL[Bp{ (D] z]k/}(Lgz5I.'"DQO_Ѳ&[Ho&q*Ơ莎3]^i2,95mvI]?=1ȹ!# ٧NE̷(ao]q\qZZe ?XiPeߠ"FzmvG]L#7 2%O cɉ1q Yyh֧[¼v[CUk3Y>s;ΒgMtgZ?{ "FF}^ޙI9{z%ļi6Ѧ1 ~c}4|oS n Rݫ6 `p(r1a1zU=;gm4ԥk*٫I8(s&u*ؾ{Z*n[-[B{ErLsbFWK`dw ='yI 構tgr#$u] wZyz}G -=3g&7FI09#Yڼ[Zju>!I3I.1-\jFO4@tEC;4.*h`KIzFKݍTw_ t`2f{NY}rHm.n"$jw y$$5K6zsL9}pk r:IZA#Q)yJS9}7 ; Kμ4x*d0XOhKfmW_7.E 7 J@FpvYXɭK`=4dcq"0&}--Ck>0l]<=MBBMRob6L>Z.уD@ tHfdzbM} yIQ2]w!cHCx;iIqҡk3b k.k΋P T~T٣P-(D3+(DG+k/|O?b}7@s7"r*CR05u!C)žU@a }? @v$8J?M bY7So>.Έ.0= 2aK!!Prk@+/>dm !cON9zg†3&6"@DuL<3eJ*>FKg- %Zs3ԉ,oa|zb( k}) Mu1_$)ETVzˈ!4pG&Qوn˖ Ѡ8H厐W,*C4iJ&CYZtIOe*4pnDۛ>;`;fQ%5Wxi&\ u ֊r!ی`=p)"y^޻m>R <̝3"M/]#9S}O1rL$*"WpWPFZ;'p}77{\j&G3Iv|қ_d/$wY&D؂& GRZ2?aJ?_[_+0uz L6'-f?16f<\GL/*~%3 sygup6EULK[X`vLYe,xiQ }vl)vıb>/nqW+& SROd]AG)S tm*)/߮%k;Q Vd_`QlvvӗaS!+KR;R>p)M!]Kw R6yq2,bPmx>ΌdIƒ]t #記Yp$KHRy"0̪2R4ːC,#F1[Y@',73bIb#9Yӡ&7sd*iO▎UqT.' f\j#q.8K[ ~F63]5LNTpKI,c:Aہ{=N ߛwģS@w) (đ{wwZ< ɴg܉f"8IpW-\b[?1sP" ܋% RAD OVՄ7g^EKF.F=>hp(˪ G> 7K=C5U@~4 7gU:Yo'ʄ[p!>ʋH&wv20H\F(,՛0o=2.g~lO]\t^ٙv 6[)xCakMpn{HgUPH|zȹ0k4p~U1kslfh⽎wqB_Ee\r|+Y  YސaF(\8g\k1ɢ`ϼޏ u9-[ա"xⶱŹc(XmˌE"(HFz^ AM#QڶelU7~g\YwmA.?$^lv[O x^w|\+#a$-e~v.jL3Ү%X9p5~V4(_`MOzDWxi+2> , D,Ni @veCk߅|M:svٴtIs*4᫄ƢWl$g3 񢜠^c?%H5L/VVvc1kŝadD D]m|8J?FrT*cfdg߽ew큇vY ~]"Z\(~k2i\[5r}ݴ;eƚJyhs]6'ʽ+ On@HVD_6a|%UVVLc*!zLɪf G(xȣny0¶n!zZsQyX2n&oJeyNiXw:\@&(X< dq2uKo{kB (dZ]y 5qUVc1&fQfWiOr0pmsnj6ڸ2?:,HF8s@c=ĺNAaUlf~3:_Jz|i E&l^EFa:Q4z{mPJnS֑&O9ktկ "p < 5(M\yEҤg3O:Oڽ*a/6bC< Ӵ/DBŔJd>w0K(F-h~B*+ J׸AЛ(xy-n8栂ԸXjЙᆔW>94<(9s7^M<v'?BIŖIc=Dǁ;I@E@雖5o8wKՠl NB&3f{H፶'WSO Cb2k2m-I.IpV4ku]q~D5%#/#m`jB?'B%pӂ (jWW*:0kk߼1xKSKabfA:-Ӷebgq ؝18ծka#Eɳ7 eqE'`?$rOMtܥEѵƾre]KǸj xCҾX;KRF$/Ap-zuK7/ $CHS(t÷K>x↱,73z-;?vIž㛃LG4 &+D,yOrGtVi9sHX>q͂@/5Xwjx`7ȧp&CGZk-W~T޳-5P: qˤwDb3;v ɑ7qt>J~ Vv$LH4oY'݊x$CBz<مba&^A!ɶHbm#iJLfC%Y$%=N)H\d"e-S=q)-&;u] U}Wę uZ@K69X(U)}}.toU"%X[ZYFhF%l|qjVwĘWvZu6a('pm@Hu+jD-J[OcU#9|9^WIvQ v-YP-~ ϲ`kֆZ(FCw]"HsxD ,π< x^.y:8kӺ7Lc0iL*;31`f0\o1P {+F.džYɉMϦwR8ewX c%ذLo ^Fo`{*!g TMRe oV+lljf}-/ OpKtXKCeG%~Xq;@t4f+Pd ?cX9Wԝ̣iZa%CkWbl;";vM?~5}1 &!ؽyF/aHKQJ'b:L[%XnN~RԮ9U ^-q(i#cMM ˦XLkO0 *j+-!(3`X=4EgÇC)~4e29/(gRиd3Ei~2\^>2PgHkVWG7@ iZO/:=lٲ8BhD%Z,,g1K >gp/2m|:rwv/M²Oغq`{]-kubӡbRLGUF2Yɚaq/c=>?6j62ֿژ*iۜZ'8>ݬ#%|im%bV"6I:@2>{l%d7mR]TM#k2jӨDX }(6c^3 E/À474zU L[:&Ưjf|s|࠴&t00͟A4D }0a[z[^P_ahze= WWJ)^|6D:SzB^Gm{U{9 >j1O`mA"٥WO S%! aQ,eiD>sea+&5Ei)d²<kZ.3C"sbT;V1˞u,iaGc$j|e3|#P+Sxy)]̼qk@>is{[]Z} /$[*81S-B[4?Dt^P=$3De{o#'C/WUOUXjj!X\ܙ_Ѥ͓:mynb\( [HfSrJ)y%|Rykb D85MeqTSӸnydzs77`Pq]&WEzx_Y )`5 $˳ Kqg>tY!Sq0CbJc1͝ r?A>LǣφJKfb k ^G7Z7Pz:[l%B")P9VB MaibTjV^W56c&^"?)Ht-'Kfd64ɪ0=.i*&i6'͖BG:`=P1%9g6}0F0SoX)j2+fLllu彀_m1{ Y oTB_ʩRifk9LE4yof{*U";ƋM+Y$M&pQoE+K^ڞZmw'm6ɾ졏fձe$v̚c=$bˡ^oєK/o+$ wrdO N.vPmWo[kxZz392&YzFA򪓃<ҦppB@lDS*:&0OQ$ Kq Y'UU0=͡1 C1BО9؂ɓxgR;03h 8OSv(BcF$kxp] LVyy,Rz6+aK;RQgy_+س(/fK處':D[G€ߣZ_xXWσ^,bfܢ O6^-Z IJI٫bՌsƥ^rp@ HYPT/'a& ;Kٕ)0CqFLМHM,ø|䖖F-g\7w\;NűT;} Hp5N3b@Xr.nofB*,pX_gq`G '~f==ݯ # >;V nk~*> "jjtkPO1I]p]UYxHB_DH>}ID'j^Yzm+6I yR p Κi<30x j }xX'{9AMAEFU'!t'23ˈ2ϻtx%fBvΥ{#x4ɓp&6!CujKfH}}0'/[ ԛ݁K'6a0K 栮GҺ+ RH#Lt6K^l@h{GGAhm4ii-sEmҐ~4l/ɍq@{BQ B FBV*XztyIX^%q/ގ L\slɽ72VƋB⊭KȨdہ$^ďb5ttVˋiVP%[P>(ࢋRăb@ RVDgt̊N'ȜsMC5% I)MC. TYGxݰ8DWX__ArDR}뻷Z Vi>FgIX*r֗W'_53ob)}H6lhڂ,Ƽ}\,>Jԑ%te?[> @}w)1\zJENì. 8:O] oDc Nt'i2||cDr>{-]CrmM9pLwHE0WܑhDuDd]peXri! XRk5"Ùu/x u}Ss3<)N_pdžT0߿iC~BX@v*ϷQ6\!6ؕ"=8~ҬMɗsTsNLÔ`o!ٓlm$Rzu NX * 14wMITR9 ;TuE6 W!1 JY4hs9=8ij7uoxMTB>9XaH<<ƙ:O([%ճOn1y'XFZF2I#d 7U)ERw͗{5GE/_!-Kur$FQ~ %^OqmisyV+ևДf 8o 8Q"mL`t%JV4fn=t5- x9 "օ`.ʲL'枑\yysE=6$ 6 AlqMwd6ɡ&>h?xNARp[O^R/6EgUljt0o .B<8$B,Xљ/j*-TԨ:f)Spm-| ޫKwwCIb&pYK^1<=d"-A-^'+zVyY4H[R<)6$* 2cu=gƑub-pΨfǶQ ]A&v1Vܛ&āM7v>!})|qkP=2 G*9z4ڕև~ԵsNbܒ2 EXrr!0&]= S]sM#J$yYal=ΣBXue?N}uGU8ժ҉*h)c'r&ǒ8#T)q:+V7etH; ʺ] ~sVs9{_3v\a.>uwҥ|ʀlvZym)ˡ"߯)k{l-|LpuɈi,~@(AX7ʧqP{kzAĎ4+iz-s.더& d27O^"#hfVpyyi8i{h"@@A<0+M+tSvC U)+2eY04pU\}+@oCa}'(|lٶv"`C2&jTTc%Ai?,ʔ`NRs6$qI= K9-2#% sS,~N&=T; y1=>n,R,]#;+wOk?Aah8չ Z~~{ȬݚMN `Ϡ6=0;48Y/:4w|KS%30̸] 4JGrH_O G pbi.<;Qx'$vۮB Wf=C4f;8Dop1Y:--?瘯%j pɉy47!@AKY2|L)[ 4r>BH XJk6~?,yW9أ‹9&&ٙs|.QRVe ">P;NZQ&@%3p@ 65xNZVas)%6 {4}'b1s;"BI,:F6HwLDOwu,@ȴmk\OfG\uؼr 謏yL:DqEǖ|[*%7RO28qcYzۋ؞l.#|[Ħ8ċk!V{u2`^aZB>c!r@FOUx>Oox1U$LL>jUKުHAlS=)SfXT٭V}f7"Jt;,}+)CV GGCdɵ]эRLB&: fc.0KX4u}s-jpDC1nӫ`7EO,i$ݶk2{3}9!#.2+.둠!kKiqѾʆ0^NeXw݆^K {k>QG]Mf3 O-NQ;e8┥dE dWNqO~I6nR3t]8[и}%"'~+ݪ#@Z.V䳌軲3|~B|Pc5NۍGQBT^3Hxp</sܫKeHN "|8GZS<'~r#4<`dṘ0G&w+[Y}LD;?= ]a-T.S(ى$~( 8$p&<l67NIfxrD[\RSgp*S0DDq5:zOqy]^{Ivʙu}}L 2c_DcI۴%|\TU*& <36fљOК5m  ;:[;sku?UDaueeq6Zu*0/MΥ16l(@@3U TlƞgU */a7fz1% p ;ۚcs,_"4xN {2`e1J` {my8rPM=Ռ摤჋)\@U5P/۾5.HQ R ~8١ҋqһ`VUEp ?zNQzF!b1:=ۛPҷ=`]`-\l =,*x [ o2 >3;i"\,-e%:7!bilį/#pWPpX]jz`.gig/ uIsgbLQd0WIJR=hea8'rp+/#sL "2Bo(gfTis'{6{B?7E 8~wTvR$ $r6MVh#ņl;ˑkw^څ2=;a°跻o擄9#ד죸+kȻQo`wIk5Gljp{+W1wy 7ݜ0Z{fc gީMPg,ul]RFmQ}VrМ:#\AaS+ZGk {H2t}[iEsj# W{ru49L^#{R)QUkyo6.W!+q5,Aq "j D%/9 Ͽ@AE5R܌DBiZ$$ٴ!?UzBocYy;5)м PiS>eSX DĀ~+? 0s@ @)FQwL9ZI}$b{@us)lΫ( +cuy_{gq5' W>^2F̯y+x].}D,{ IMk2>u3vZ ?aU&u.!R,T#tPt}J Ĉ-7 NrJ% Sog0/GW[ H=|ETe))|eZ^B2&sؖ7`t_xtpCu*,kZ'ߢ> ,li5+t@G(gR|__$ ǿWT9R'X=EkyFaΫOhҮ4%eu8^bQxY3H[T%uKL-;^u_G^z04rurE :. `S' h)H*A;)O& ^1-- "KAGA]`Fɿ{Agy`'p߄=KtgFfg;9IrN~W#(;G': ;Uu87"D^@`aeOCi(ۭO̍|PT= Zץxiҕc7t H b52IBo$ ` VHۜ@ eW:=ߥ,CF’˅4/8 FVN}}ҺPM!zbV0gC$.Z!#3 L3 B2S̈́9oTDslٟ,;]9S.~F23YkL4ӓFn[ i]no٩lU1$YAp+4"kW9"Ĝk Bf̣͑Ȏ{a&MUUcL(M`ǵ޻  l(I[.M:ZOQ̿B稔AW3v).y+0'P\w)7SQ,#12cV z;}?$euT~d_k憭s 0@(5$&b E3?b6GRk @ xK"׹ɋ6}ނ3E-(A2p7_1_.L17>@-LҶ4b4/",`"Af.͸Q >eO#N/|(=.Tڦ+{F@$[347}F<K8v4 0GC[AaT$wn97Wbx&,$hQgt!2p)0ﱦN=i/.,cR$5->nƓIEΖљBBGcjğuE;UMqMk#}dfU[dTֱO3^ . W-ʈ^c9FXbc Tt|Tqzw8*T(^J+OS!n&nԲf#Ǜb0~G@#iiIxz))Mk2~}]L6Y>̿qsJL.ff(fٟQF|HTpvE XH^g{x:erkdJ5l@bv2Xدn&$t]x6N6J}9f&qD`WgP 0W:C pгK. ]{_V6E=N Wb sBwqe~sq@5^d &'NK]er;O7jZNe: 2mXGiZtJqq+1xάc]ΌD`yLQ7(_806=V(9{W 2@>g9 Usj+;\J /~~~TY*SIg <]uWV! *2E7SrdW}.-⦵Pͫ.B78[,K򴺻~Yk-N$K~yլJ@nfQQQDYhpN{{K/𫐗oY1+ٜ-ok9UY#J>z$m@ $(uضTMgQ>L)d-bZU΂V_𪄲agE& /lkÊ}3fO6X~50!nul4yGc4|؜C[][MpczrGޒ3&&Ο|쎴0&˧#Xej\9C9eq"@>mEz+Uh}=84fLrg@ Y[MBfWe0%P֧*kBE;ySfѰޘBp^/,A( i*Yn2;N;'TAb`'&Vo6"Rb hdse8[ʙrRS;1X! cQ<FhA/k μ2@IyI3Qd_A3iPi=i?>,m^'C+GC2pnH!MրEً| Z1Ic/: Zg]0ԧ68}?mmsҹ[A3aҶ$wWaNf(09`W^6?,JY~"P7l- esA"m9'Q!Ji9C$1ѷ9Un麴 ~VA^KWuc2 W, Z=WErKH]@fmVot3[zJ({GV!sL,On,@қq4 ä0}M#)1r?Y\'|Jvy+G9]%!:1+2&O#3xpζ ӹksjaWtmZFU 8+>(Ĉ|HMNyǜ?HU⫸>Ve-'XU_OD C׆ ,"hbyդȋDc)}BR/rĦ| ZNDJ`vd b܌R*S;d)TU&rwۙhG_' p}{cVa!{42U`r6@Ï܌P tE` ~i_$aL!e6F廕cRV71J#ӟ 6 [lq4 7 \}OHQƮ1)f`)ruyUWd ϪJ=4'5Ǒ|;!+{j$sε]esZ 6̌-Gr{PǗēȇP9<C/^J  Fx:Gj8TH^mdweu˘[ jL(&8.=,0skC|U:ѢN!܈{'P u H{.xͫyf лh3Ч> ]}%[CI_&jhI %52f#\D{8]~'\Fi<% 0q(?.F%r'd $JDu(]CI UHmKU&0[qTST/aƙ>VK7%1HTTEIr@|\rO|o(q0kTTG hQF1uj/?yU`$bǞs(GlK`J,ݼ קӹ)$7H fid7I>ck6qď|ʙyW,ſ 8ce{ТyT W z I?ˢLb/7H@yhxagG/7 .1"nL8zG0f $ -1?͌Gye4= JQsX St;=GVu@-:7|.#( #"RuRr~ˋae=NRm-ԋÚJ`-gd:%iȰnS  `>Zmvƭ/CE]ȿ3,n2Ř%@T1;(&|8_ ] rD!ɕvkqxȎElDHup+d <}.M;YIV aX0nlsZT$M,L0cN{ر.]ĵ`(O4UcЙZȭ&ת$ig]dW^d:t#7d=C _\:cijbe C8 ,6opT:95 O #qU,qzvbX1([DtMӞ[,ޮa4LAi9g?Y 6zҲ ~9cd_3HwKC R|SHέю@tdž A o rfJF;(FJH_ =X|Ol NFBmjoۋj6)OO .Ś91G-_{$"uD5PtBz΃Zن|3"GstDWzx*H#;/aQ{bVm6lKN ^J$.jV-2g%t+.d rO(ۆihB8{35w4!\D@ kc_K;J\ttG4eO iC3x8݃p;FsL4뜋sQ6֨Qb,Q2` &5m&`l]),m,zw*תgoLɉ.7/,ٛbGLqET9oFuxJHIMQ_{9U1լ} fQ^H~vtL:D;w& C0U.rts$Zv>zZ4dpԟ -3@xiMFhz$'mϮ#{/Ƈ̓^]P 2w+-}׷:15^2UU3 2g/끆4Xǂ8CiɈn'ǏeL˛ ~$YdW,yL\:rqsZ3qf-hSF2m.5&<_zɯI7w{BOAs0 P({C*T\2ʾꧏ,R"iN&(*cJZvJZWfCma[? /.9ÜH0~`C`FoҕZ]IuHÂCSUyI@8>To^NO."GKw}.GP26eaMf35 2":7"k)zq%q,98Z~?Ӥot I&[k}H.hwln~q5Oibٞ^7Y)l x鸪&&]yHCv§n1;!Ӟ -\ۯ酳M󣀾l"~1G|`*?Tf(hvݧ o*y%ӳwd$LHаCy-fihwɒrʩeWKF aaj ~B9˴[:yAI ֥B|=Mpl+rK@`(kIOt \Ig$.5_ ]Xg 1%&V礸 Fp)^4R3"IX\?:E uW=,MTY;g=wveí).LO>frs6\]sCPlٟ2r}ݙ*t͉'vsY@ -5ljQ70:KٗB߶뭿3;tOFkC _ѧyiH u25Y` bGD'HJo +ݢOKsdGXu|e 7yHJ));(Jn{,}]b=tH_ j%!=[h!r"0! `yVBU`S:bټZ/ ^{W$m -=#嫸Po 7:orLIP 1\X5R+P#9z\&m,n@&-7\B]4"p [ۅ;Mę\g7[#R8{I. j݉Tj`5dC䇥ع&]-kܵN0'Q3/[6}$}s&{dh҈A5͠Mo\vF^|O'cj*_&;a8Szo)sy˛}twAs]iģ`|%ZW}QzB(1@Ϩ3J9g 4}PFnW$c>| fI6U2[3C",RЮ֠ek 2Ġj.4kzNJ̝X2C3#喈걶4"fia?Cea7\l WuJ볛؟-9s*,U)n0vD+OwjF3KF0Q Z^q%\g9__ڴ&wd y+xNHPY}b#=̳ )>MΎtՆRV%NeǕe!/VZ^mq(nfB,QQϑUFTiJy6a8j E'Z魅aENCP{F䢲䳘c̸x]IﻜˁVAl|hD!2LU bsH}UY ~ZyM^hc㹕r"ON'e({e_JX "rag@4 8) \ЭcE9뇓R" !E1 ktz6혿9{Y~8[8m'ɠrE8s h^&[.L\yMou5lbl ׶e|v46ptȬIIQƶ! 0:pDŽxxzI8:o^whϭr21rw5<Sf,`ޏM?G+*zp 4d|F[1Du|?Zc^+2fzipiQ#c;?wkGּ ] 1 kIHc*QXicRS~(i`nBky\[@ZBN{"ΐjH?i."ψtt3՟a`R~-yz۞"bL2Qdc&_("6Č#$ҽ@>>[t8m R:{Ԝpʦ>v{GDX :^]Zk,;[mFxk*5{a>NK̨*%.i`i>bb~l+]͹BJo>$8@6z3\m#`VNBOn+Ⱥ)WM:Kӻ3MlrZ-@D%(}`vx K)E|h!G uOlk4`ֽgi4ҳ'|)}Y`jPetHȋ6_9;R0M MU'Y^` vrGzghYXO1 cnRm\ |)p3@Q lq>' N3py5 ywK ڹ#Q0,; fv/ La9t$R vn)JF0UGDZ6K٪sQ"FI 4p8)ҩYMԍXnZ~%: mxڌtsV2<t[xt1wwH1kl1JIe>"#n7Y)&0-ñN) rQkI M4lTb8^'G 7nF-sp}妬2"$\jxD?c% 3oaVҰx.-4k=W6?iaG }]amvhx58 02/JCqSh݈COI*U$!oPmajn wuzlJVޓZV|ҧ׋ սdi#ޕlU5Rzɍ3/q_Fd}8P^,@4brtOˎFBDQ# dCg ¼NvՍM]\M`ˈ؎zR$aq jzgS_rLl~)P3f;V&{39o&͑BÑ`.l90EeKo%jAJRV?KqP%zuKtW'?҇t*cֶa>> .e:ڵIйBc vܵI.N!A(9cаNjJRֻPѺ.d3g}6HK*{j ܺ${8EbE&T]_¶CH*Yѥ>Kc>[WQNM=F [2A@@hςk'{xb1PrAHWdQȅ=@BTiqߥ)2YI0^{H~4;xpfT +[O(+/"=Zw2|Ymmr ~D:ӎ;&]Mh]$I1tD ;.|R[Aa,o=>a$mX"kUvƑдry[`%=C5W2 yA NR. PB~,CSe.wϯy s!kfg-jͪS~bZU˚ ٱ=o$q9)8YƜ vak(2^yS;3C(PpKk5P $#a:4 ߐ`(T:6e>FG[WGbw@ '^NӡD|~DGoHI zdt^X 9}d1 }*^;QX\İI݈N+iE悽Şob,ReaϹDS QG(А??S\k*D6'|4=~fpyD%atb_X W Z_J,b!8fσͣ'Y;[q4>07YWl#2~: S>3 (`nVwn 9WS\38|nm*/\.tY6Ô7SFNZՙx˂IsnH*]ژ_`juxL%JŃAV 5-ݸNL`s5s"-pøy@n0ؚӻH yZ"oG-J+@5gs1ק=Ѽ 9;lG[G/+ P\Y'|l)%( Gqq|R1FY +JSp["i8B-gϢI\StG_&(DFF0Lw3l iѻ*LgG ˮzMՌ-3#꾻[7:̾F 27i$tTgiw |WkZұv8`Cԇs=Mv<2KHjOՠ/Cc*'Efv%u'#8em]+3 V~Plq {cix]3|ip W"@yNk~r]1Ԫ |#?IMJΡsUVZ,7OXdYfh8kiܯ||}esFJQ~MZOv M~YP$~#}{4RSO=r|ڥ?KDdI<\X,6Ii7=EM-{*ABw%Xvb:uX\R<&ae@uط=E$fV:CYd84 mVo5G}J d2!A:CG5emr:u*h;Mξ$\,P]wvl(뿕dҺ&Cֳͧ[O]}W*EGs}:5O^+q Km:tLHh~*<[K4pƆEcN7Iòg(q/U%Ks>CE%Tȋ َA $RߓZ!A"g>OPy`Rņ\/bu^z۟dF .Èe%h[MЁ (>lu*? yVGNMvyDà&MZ|*܀i٬XUu!>s49Ad&hD+٪:TƳq" >Fs/(RQ"jt 7Ŕ 56Ğ]U<{W#?.gGﷴr,OPAc{aad!HpK}DJ~Fk|<O]ϬȓOu ha;h}2|C:>#O  _۸=/K}HnlrNԞ_/ >;XZODy#H4ChΦ>r Uy֗KD.0wT%=>iSjfe@JfQrz /V~;HP.|'r9Gh{2J\2ּHW 3Ue>7#*^ ~B+eg*ez ezC/Ǻ>Xp%Gޫo銨'HG/Ȧq =SSLocRZЖ 񍞨 4JCfaU'UqٵVKe`%ro'ݤ<{@[H${r$ q04ӭQq /?5zonXvr. ԸT+ <]nxEwt@I:r"z. yuq1v,#p-cΜ^Gޡ\ۿ)X0ȳK̏(}F ,"ay~؀!;3Dwo>o7>#>ړTL!" j )dg   m^UIBh7BMd;G τ峹a5j<.@䡡1]C_NtdeWmAuQ>ȱqziU@s$*noB6d;74{ɐG’!# TI$*_648$sc0sKIHSe,=; dEIKޖVy,0i?9d%X :B#p̝{F8D.ᓝb#h2H' biۯܯxL&V)Rw*Kh -ɜߟk-p5+Œ,;=107a.u#3 YZU>Lkbw! a:ׅ֒|^i-xpEn'iиIeN&楹CРD6(UֵuQe-ujEO0'b!~3nY Պspc)#OsՓul\ }ar 7ҡ7f ~Yߪc׆v"Ȥ"mh $]2h&Dy<:#J5 = ?h:}*ZyR @B "mįof/?;?T}4c]Ry֭neJ[vuQcIpt휢 T5 |EXC ev?+KM̾p=x*[ em;GJt}ŏN AY@/DTkNn3Q>#6E۹xKU+Y>eS__c˿{ +d![w(qyb1Q8o_*h!+68}ÁmRpa3 /7͙፶-=2Cb3yei"}DM =x3`wID{(3Ȯ@m;oe(u =\YD[$(LXfw|GLw^s푳D]zVtѐnd =yDCz9l b8~g pP$l{7g͙6A\pηSh]\i8s O\EQ3![1$kml +mq@UTdI9YY\q#Ʋkh/$'?TA7ü*t}`O|y|T,Bl:" YK 4ɂaa$v*x=Xp5'B |3-8gT^SF 0R|;!/(AZSOWB2dL59Ɋ8gXtd5g`҂Kh8!:5)e!wA#Tmπ>=2džPei""FG`Z߹n!54cZ -<] \̂!nYwVJ=^'0jt#}қ/YCO3cBOF^.f$%^9N'?Yk T7`@D.; $E߭N̙Taj->G._Ѐabhr=-Ԋ֚%+_}tԍ%#0Ɲڃ*0(֏Eb :Zt{oTy vsR397D,i2PY%&EЙʗl@8Lt+俚5Tpĵ 9%b'!qc< UJ ,0UiCh&[0v1`j}BVk {3%0`"%4ޤ5qH "aX9ZP>S\҈~S} "SN@XҘj% ]HY0T jJ%4FIjEfד%UL,KTTޣax?dr8z+ou 9 |]3 b9 -fVɇah+?TY!Ēj˞n@8?v3sJgzCk#/>l/r~<IEc(*2t6bI}eOo~k{עVAwEPv"iyTGlE>OY*qi8B)t+OxlŒ|S'$%fuR6͔qS^W'Ѣ%%E/Qʿp S n3F 8 X4{ 6Ul1zI Ӽ|g~^}OzaL'Ebf׺ԻdM^1#7FO]|!`6X3CYU"񴡓>^t9yGIf|Rs T{{)ߢÆ[j*M.+Py e t㿣nY|cEK ày8@ .%!4k( :Dd/د۩<2hhnzi}-.@Fj>}̨-Ո]`G+聃da0y\Ts1|h@}^a"* M\Lx#.w=0e9W8:ʃVv!ّ=t/5uu&1CO]ׯy;FNnŽ736j}HB8㊿#ڃ3Ӷ`^^ɥ1ZH7, ɚ>qZ #!4|`aa>d‰V@gS, կ ޅ*]FEt Pۯڅ>HVqz]o6xlQZcL~ݎϮC&zʈu}BW!lƓ'b-}SL kx.-rR}"sR*Qۆ=s2sݧxi+3}Cڵ7uG5vjK oI:rHjĵ- U[W&Q>S8v0j 6g$Jݒq9q ZhnD.,}M$Q]Xc@5fDE+ :HP4 Z B=c%Ly`a\xfGQʠ k//}FPvD҄VlViHO!sS5(*N$A[*J'M9hmä@d v4#W6c2PrwN:SnNEQ `?l\0*md qMY8\%[iD2d\N¦jJ`,sȚDS )-`Ys.jaaDnNU-BoUyCK3 nU.\hۃ]ղg#* ]A2ʪ%S p`Rx5Aqj U[nrM6Q, 0Mο/ wy89w+aY ^ Z}D$ XX9۰ܿeޣ}06vtmPfJU>5@ؔduMML:h^տ4w6&dگUƋ@7:NMx vX8sD"Tfu*A6׀F0zK_ 4@h{p]e1l_H5kttm_*olw/DTF<YodV+R1uS_!Q(RVqhubxHי`kE :Qf<Cr "%yi}&D|k(fRD*3qf493\v!ɘ}kAt9j#l`GuEm 쌳]00 D{]kb>O܃=5eF?@~)o+1]iʃălj\*>72xJ `%W adEֲ~-_wJ?oA AlJXJ)9g+XMBxAQ;hM8f}v!=d㙶l,/mNvF0>imz'I:r/+GVW*΍{NGO v䅃g YiA|c$sS }-7 f$8`dzDoXIgjU;OrljӞ@؁JJܐcb@GHM]16*(~<"o"CdwvIȿŕVKpa^1PSc Xy8y#Qn^.Ft;Oޤ(9qtfPMkn1Z&qqBzn`,ۤ$coPNr{d3tb?()Aؒ |5abgJqXy^qu;2BZ64|Y@Iwfӄ =f$b5VB#kITpQt԰FKr]!Kpb#F3J2*W&NYg;Cݓ/pW搘tGVv&̩#7U>; XH%ݪ>]yԌ+wT%u,+k=yES*dn#҂l 7X"2f!ZT"eӶP V wL"~Lh98'1s\B%Ĕn+lCӇt KЪָ|"f?E^"G$E..[H1Ei bEZ]ct06/uyƭ?3Gtt]~i%Ԧ:Ws 5d{6^*ɩ?@<Gi 騳kbc7l nrРh[,³E۰AZ+nj8VahOgn:Cr}=M1FaOʀf:z~<#q0rU=Ȳ`ÅT,NL;ih70&uNn;'ojk܉P7ldO-&%`F8(&L|zpᧃkWm9,r!rAث2ѷm#ot;Zoʃlt0[ *,iGkN0[evRǦo8PI 9}6!ҝDtsp܀8b`q8\WFvY/\v^Lw#2M0Y}vS =YBppNVdֻs)L1#~} }} ,5H^]ڳt[e UDn-W*CѸ+?<²GlP@m :ʹV!SN7V k?%VﬓPMRɘߐev!k!( N,@e:j\a;%X`̐&IaM'ڹ0Q\_ iJ*`a,9*)fG ,>tzQxoa7>V^ʋa{Hl燈 U o>ire0\/u;me M@iL{.KN0QvoAaLv|N`gWd;n?$,٘-V O6t[ 緎/Qb&Q!#´|==ơp|+Tۯ[ʺd*n̟͂H$}zRط$al܏?I4A(2m_]6tVzK5hHʄT+id$ ׅ}i/Ӫz9D5==gȵa xAgOYRTGPRqWbjiߢ&xtX˫2JkVy=mܓYK(1Mph`Q|<+2(C3;N0~@g `T\l/)wliAoKU rta,@ЧS;pKGzolh> /Be'O,$WN@VZ<ř^_i>z.Ŧ`NyҿD"_#V2cx:OlDE˕foI Q<ȧRq2u)ecj hv!zQpP} B ^mZ6jQG([~r& W$NEe xXW(*(#P1ZMC-eIR"B]YcBeqLczZ7OG}cz_R [k+X iϚkn&Zk!` pk ++>N.UvE.6B`g \ħST`BQ[A}Է^ Fcv>=V;SHh#]*ȋ+W6^+dJs2ҏY2 8Kp ]珌rXELùT>r3 n@փzqd*YCQ[Edskέ,e^7ɤ+0^ xi8"hLzz6Gn^ @_ip֓}EWG郘&3OY3.,E>o55baEWIx,y79Я2x/EcDՍtبտ?rVT+DCv-E0B<GH|C2s[ֻr^MŽcA!6/?,=Jf^ы3V)h‡&s#AH\- >9LUܬTC"]^˕o/*v&™6|"YK ga\dg? 3k(5iŻXpY]SW7&Ũtu[DW9w‹^H+&ꈥw]AG㡲_dujyꤸl(k\kK*hQ0fE'sdui43LqTy[k ʼ9l[ K[ϷMOWHTp= *YtiO8kKtǍ)UOqU?};$Nh5^f2mߢ/1k~nž]Kڊx4/Ǧߪ1B*qN+ lu)[/~\}I'Ȥ TUMX)#8;4#!ѡ€vbj)Xݘ~֨(gi12eܚXXVv{s2J`٪}-e.]Rۣޣ`P:wBWyZUo?q-0Tx]Ti =mIY TN0Ktx`v.yj\_% B9GkTKH mʝV9qYyaX*i \ 26]-NK[& ?O;==\DQLu^@jly^>UZ`YA zFC°>]}VXܫ[O$0NG= 6>-4*]#hFWG+D-G0:VTpQ^M%'+m9UW?uR,p8ڕ&b|G쫰pſ8vEYubz ǿ_X*i~ ,9&"rtH{<[/y9fl|0? % B43 C B<{r:L 4˵X7Q: ?~0w)RM_[WZeq<*N&&7g;cg!w4aʜ 133 u  %DΠFs9 C6'XP Jﴫhw9۸jjK|}yR-hD ᲆ^Fŏѥ߁$'ty9}hQ&˴C}[qEd-_7ܮ삱&C0Nnr ;crK6U||$sm7`Kz.X+ςgV6kxd%dU5|`EVDgaSņDqWbnX4H O aj&-/Uj6`x+0~Yͨ=$! i+y67x-[PR|(M`:z85^y 難7EP@L!d}u{[ v@Km, emvE\֒iők=Hik˖.H}H~6U$apXo]ucڮh5isi(Z;FЄt (knWدUE1g(kJ땤ibi[$_ÙّY-Qdh⸡JdH!ğCm ?#]\8YMR r F!\cG/7XFfҊSb{@i `Cn%uSD1ϧ_60RKb&{PاrT☧EƦ5Ȩhg.,ek*2ujo]mE_@u UeUj9?d7Ogl- Lxcw) L2%Ȉߣ5^-ٗ-Fx1 b&mfT)P d:K߆~ƓKb6Ud -OGy;yՎ>7U׵gyG!u' 6NN=b؛=w76a "AZWO Yup"i'PzQzG]YyH8k >b=4ͺBo8)VyX:jc(rwI;UPi&$wˀX kPSmR0Px #k g [֊3KWStUÉ[[*{z B 'l >"M櫻b#u=R׮-9faaU-ptka~]+}吉je/Yh?u:EÛ۔u6A*lkנs>RѨ'.0cu6!'6zSy|ԥST#zdreM,zbB9w<)82+ s,y(awpvFP(៴F&8\0R]qN-M2,5*U狑>򑶷/$bNfLޝ=0HUC݉DFĴ:#tI-.Fᆿ~Η㱽z3;\G2pZN0k[PAذGz,L/CrHm׎.ñ9JA@[ .9Dʩ#|u\n.7CYIFuJj`qǓr).&%Y&Qi!#Ī?} =TVz2;ά6n5 jZFmL^9%3*2}z9@<"(0Ks+2-V[KAH-V:B 2<]]bP LtqJgv([&&iؔ9A}4ai㥣릵pr:nEͭ ,H=%5$ׅ\T<1]oMđX;43앧%m8*UV1J5&UGƨCi~xVXj B2_ w;TK:F -T{z4Kjyϋ"%f>`ә^'ݴh˷Tӽ !Ra5$)z̼[ƋWt}ƅQ`pMֈT 9y~Lܧ`ϜuXIeQ5))3nGAx(1}+j TR)k}l86pH-u=0\i (TZ6 +mA_hn}'Bbl"ۧoe cmz\]u>bE:P!I=ߔby&tzW(ﵟSo}r!4g=f3 ඬHUM?G̋fXl#1o=f;02lVSt&dkDZ៣w'=C!.Cnsl뀎~9YK/";'L~IDI472WN⠓7yBaPo-'N,ݤӰ H'N~Z+[P?8V$@ "4˙!h0⹯MTj6Cp`SlcŖtd@Pl&ƜI.u#!$V HzVo3o֮X!̔OZEmwbW\ 7JyJ8%FF3sXc4p~,9wrZXtc>~tktc > 5Q8)H8(.ӌٳ/G_Sia YE\(>>Z_YMF@T=[^: WW^J0-('gT83HN)>xRɼ $7Q4ƅ{/!hb#<"W u*uin=FT^̏լWdz`8Sw؃5"u(2N6v$}7SE Rsψ%IyE0Ss=G(8XuFZ_żKN*I$7>2Vkcd5Bx)5\.6761 R+cd!<(̓G-惂 uϣ0: VQ Q~ڦ4,Hi')uvˮԠ~2,;E􄝤-?V1>~J̈́0uhQ'>y#\*MXq~|T5V0_l O/@,V-n? GL"J`b4={o([ƅ,0藠#x@৤V9"[F'm>s/"^w~fϢ jm2oAt 1o7qk ]`!PUFD|Zڎqd@?2jmJw; ":)ݴ(SxzY,fG%+ KA&+-e9;=5l&w4:vYy*8f@UN&ʼnԊkP$ ?촺 ३:oVYh|Ks_|6(BJ։1F;zCh6`)5@.=0H*ddQ Sxsq]Tt+ LrrtA jDt N{ԣf)s%OlVS#m ow|Pn. y;,&;\j7 i'G+c*2Cͥݡrq 7Ctj?s4["#mtE'h{ee|#@sF0jRG$&D] dPq*qƂNFC*5/;TLKv=_]:ƴ)%DR _5IƔgAM@^'>3J^n !?j YvF$]c-`K^Xʣc┸e>-]&ǑƄQ [B玌n#?U;k݁ŻRKKq rᬝT I8X >s'D:|`+j#wkoE7Q/ZF.U'?{Pѣ+ɫ`z3 IK5R=,{ÜqcSsC%?NQ Zo죚[v:搂`W)׼Vgɬbu ݖ4 ?!pz$G-HmԁF%sۭH .~]DO(P a*Iþ&\ q`_NsOBY:jN>=k{Fv3 _Kwy{Ҧg!JYY[r`gS/ 3OW+ XSEu{IxT0v䭳1uoPkàvgx^qh@(+N"o@hK9\GG^%.0/!P "TYNJQVc_]Im襺 &_ B U.$l vAظֹ}CQ4cSVh L_aQDy&}|# ,+@cH>oZe(dm'VHjL[7mM$DN> c9ZqG"FkxfTOE34NWj~ ǙȳіW\}E6 B?#87* C\rc.nu^]r_:E;ԌkfbA72HDmmonHUm8!YDS+KT5;9w&ߵK,D@bה?eɩ\ɧ|8b]Rr g\LrNa}033=JaYQsb@^.d[7I! 4o(A#H%Osȼ(0R-cK;!4LӢE1QhR[pݹAy5B,` C,Zd]!l2#'?$Ьw1Gk=~$x=0EJV>OUGBx GOXdYS^.|3D RbXDCk=X)|S7]2ۣܠۍCT P4 9y(lr<|ALGw = >`Tu&~(I~E yճ3[{/,3<7]'$葰磋#),4%,V=;XSRT>P\Ƀ0sr'|d'Gw87!Z!-;nylŞWO)߮DxED :]d# Ȼ-~om ¿WL +>6Vr֊ǡ42,XvJm8aR.@p)$\jsȋ*4|oPwڞ;+BZs Z_KD g2+q6O0ڞzl ;@v7X-[ih3CTX}譯GŦPe# Iwbꢷs}SG`i &!2rzZ?X0*`|6菲Ct$f-}TGT>&58| v{xnFnaGVmx$^6DxȠ 1A"{͢a)y-H(:0CgohW%ȓ!{L>AiZ,.CmR ԦTFw!ONZKcM^cMzGo6\7@S.7F^z]ĸpY18NkUvwFb",r˶)-R2v L8n2 `-fCʬŀZw?%fxAvo4Ѳ [RGWcԷ7c>VtU¿ɪ)FmY8E{jb#ۤ מFSGAkiS;/$.0Mxuٗ2o9uOW_P;z#vPXꔭwG=H!~Z?d߳e$+` CbV 1*++tzL$2ڃp+>h2XSojAIHʹUnpKS(uR3\V[ IL}g>⌗H'*B~\QrŕM%3X%­ϪDV#2.(Pnuhn +q9Ԁx = ͑n 1]OPM (=B5L[=bcʭ%.-g\y;&LNE?@?ϢRͿpc8ІwEdC:dvVB'-\ <z`%_͹!gð{{2KdY1 2Dϥ㩯 jZIV<\V2MtvI!oDxr'LtQT oe=tyպZ>V -Q+]1\u=cmqaNͰGn {;w.6Ba%Izz͵Ҫb{>TPVN& p ^FSËR9 \OR"c>0{h 2OF2*PS"Bd^$A=bRcJ[ YeT<"VqFvg)}Hm T@5_(V7C3t)o5: Be+ keԠ! ~Ni?7tnd]~'0+HV 3wod۶J *cՌXXdNFWVF*Lۛ1?\4,|z'T;+cT4i7"8)Fi D8V}14IqGŭ d y5TЋ#mʄ f~hj#}Z/O,$Sn=+đ i+ up5xYhpz1цza愵 O#dZ.dތ a2`0hXT9p(34r{<1RJ"gKPQ O&(e3Ku٠ZϞ ꥳx0ڶI2R4b8빕 W\e40FU=ߩv%VڎI$'gMqM|*4MUp?G"5sʰiM Du}#+3rI[`JEHpNdD`3}67V@2:9^b\cKJi9C .]p B ~<P mJVU+6Fn)FPA:+HHJ~OQ(5ŕ>Sh+g(`DF~ bc+G_;F ƓZw2O^`s!.?-WÔɚWRf>}5)Sʄ:et}M-,M[e 1&•!~ -IEx~؟{6/ֵ27e%USp(44lY\Θ(I9{E`T Կ6 R/-'{Dk VLw_.hA^jur2PFM4׻{9\5UA0qP9 y>`q^JxbgnUXB<9TH۹"YtBM-ȥRVC!QCMA %$9zQcT-8]cjx=}m62 '5x+y&Jq2COUWCک`;/%gq2{t ""*gWWb HNsϼ,e1UQ  4<إ)[ah(E'V8Ni )0l,J_a0T{h,576 (i4e֘ ;Tڐ:oXeX> R݌~lN zHeܞ˝!ׯBth+ Ԅ-6'q/6SotgL}hvwփxr,s85h-f[`7_I&M6WUh6(kx@ZR4a$M(KISѴ ]?6-yHN F@zX";rK^@߈ļ|eV2 $kM]Q?u}R)ZAP0P^fd[7>{ŲlB=/.ݴ]a 澼&a_($~!ދ̄c&_zp̩tի2.2LqP -c,@jX3*?士dzݺ5دUa㾈B4>G3H_ 8Bc & 16DY=27horǞf LŞo+NVѓ[UeQF9[)Mm _;8GJkc|=ᡌWC1sVth9Wl`lܛ҉Δf97z+WB5_aA*22h-}~Fm]^^QM˚Z}\U!_$s5!b'_ r#b0A}'@c @!Y8w,m{o60FL0sM:M`䄡x3VEz} ? im& h{yӻ)}.6\m  Ixir4f[tIT鳡h|.]Zex&rbcڪQb҇ՌK(ΦĤwuI*9R:8fK9tJUnAɶibuv>ml{|Htѭ eW ]MD*[ 'ٷf ɽ u^^|*b&^;|I267[eGS2$|*?NYcpKU2Yb1~E׼Tl@P "()|#fU6.EQQ"wpmjhn]mTaeFug HyȔr nB'iHkcJLor8Zfkc_IN۬f-Zg7@S0t DFRr:O貯 b\;qku_ mt{jJeZƟ] j`+ܡodQ9GVHo^zܚECFyo Ǘ@^?~0b;7qO7f]"wD+hY>zfsy1'İG'QHv0 :gpMf.PVt~@fFQoyHx̨DJ 8n"1.[U~?i֎ WXH/hlﵠhVO_uD_P򎊺c<hq}%̻ťHe#/ca)Oh)^!.7Ig#bK{Tla/h c%`w'Movi{)ثq3ЙHܫZkH鶷4eUWu\jλk)mלA=x7u?G+NΗdk_aڏ' t61q8k0٢&[ LP h̙оA:—[K ݲz1,kM@JM"T@Rkit\Q֭.bgo|¨ ]~>*m\27gҒB{[L/kTe'iYsZi Ͼ{b+&bsiT1-.Z?Q~m;\o8}|XѾěM\q۞$f#8>< jSn)yQ/M$D79P5(n%6@pя aC~=lHw5-) >(C8:JjNz̐R٦ƿBS&[jT(C6'hSp &8%~eM' V/ 2d??:ޝ*kO~g"8qaTsQ[]r: Kz0;AޠPxP +@!l~9]tZgvƙBܝ#zE5[V+_+qڃ6Uf5IvKVGQ>q[ t}_ #-3<bLW C]LksYRRH]'0cRw;g l)ԜE 3]1YlT 38 p&YIφaq\FX#;#J=M A( ?؏+ Bn MRךbd=3PXw3R?t+auBK.q4_zQ`v|+gX2WtA ڌJ>U{q]7幵4w/6rB )YW%N1C58ά+ކմ8/2.40 _8ml)liQt_O4>\CWCB9z) kkd@Ez.:>]CWD63ҚGGہ{[" 4Y(ET_zeB [AHst$B TYzclPr eܡExua9k/&Uv`6^4}j%Dd}upFˣ, LA)X%(MH*x.}hl[Jy4%1!' +j?R=a=yWGST^dis+cFGbj1؛{]pyuC$(RW$rǎ"pLbZRiWXŹ%Y?6}(UHX,LJg>@}h%Mr󍢲zR~\ibiZ˾˷␞зYryΣA "Ot Xە7J_SFަ9mMJ[f UtgzsWamsW@$MݼT'D쥛 ) dN-<|(\Q tvfʻsgɤh7]9k޷MIjHp]j=.1`5L7Y+;T7xM;(GYepXbd)-­[ij]ɦf^4c建<VTq?~*g\v\ʮfz Y>)7y_&}2GC566M/PjuQ~ /q f;cӑui)"E]̨Mdʎϊ+,|%ԚV7\0SE}i5++3pvς'Va q?Ld}PJzJhOL/+x<.|.ItRZ);P %u?(ި+&j?D+ \3&yH_W+L吥!rW썒?7&q'u-^}`R5~ USa{Nd2.C(85e{6Zq/<ln@_Ig- o0OvM |%S7 :=]OF%E4 @:_ GJhoUBS@8$BoK(kν%1DRѽr~0_ Tw& `QC\ *⦟7T r4x[E`"7"Vu"`j6 iWO״fuͰ])h@)am}BTRޅiӚb(aRaɼ1eJtex_xUxO\Xj1LTS o^$oQKl%3}'4O̱xν ,nTkz*yn2qDŽil &Қ7V̞k Xxtvv+hA2U&H[:a+k`i9@uwj..<^miAwZgEҷl?9fRj#c+FMe)P'M$%ߴ% of17݊y4/f5(`rgz~b(ke L#dr7p7n)AALnG+W{E׮H}dN]w$@"XwN磹6CO~..okSM c4K_u&VhDB{ 0JvuT\{Bpůz-ܧOf1Lm:I7ij#@edcgцW%oLA5]>ae{''N%k={|oqcwajŒ1W<\Hl x6?zCϓU(wI%=LCqV#f)rRU0 |iuKp;N無/H*>d'k0{S6b)0ޡ\lN*("jX67rw>ak)`s#B0k)2’ ]J0`s?; czpPY+7fm£8Q6/l7Ǧ,ɰ5ƲIs-jnE|f 0&Q }f:}돎 {m$^6~5:m9b"BhUWܨ&#IZŬ0V*D1'mK:Dwqf'[/Ю~ݰ U{c86C]T4"Y#-Uc>)Gξ쎂@>o8 k@㼨-8JDgg*ǤDliIB0ԋL}:Q|FR30͵K,>[r _"<%zfX p0g(bsYZ*pnIi%SZό3a$'d7j ~5?ts=YoEdßj-;<%ߊwFw_A ScN7&)w tM<и0_b&뙄zR xBFު6bmDVJāёnK#c0%w#t`brd{%΂W,w0m:-yɸ&t#a"0VoҀ~U7r 8l;յYD%o&JȂ})~=_@>ԓzPWeM;J8vq?rx;aM Tho_n_`l:;i:RLЖKR1;i8抚2& =%& 7Zš ff&Ȃώ{uu 0Z:PbOһI9%% Iv槬bxY!"86%ylet/d1JmTuRn7^DS߮V G'=7oI^{0?.yw^~1ڛ C 2P*rH8pX@ ~Bɱ$,lu@?T< E,C,=Um7۰Ə;w\e|)ib q#܁t_XrK?>QW{Lc8>!klo+~3Vj1v$%ݢ{+Rmsd=]5ъwP54zE1B;ofJ}{|JGaR# ^IQo/p 4HM"tMLRT zI-vm &PhGPLϤi 9SRGѻvZG(`~z&+S>̵`/v܈?BOS{y@!.kg30A̞|#Zo`~ա}Eg` ⍈h|ET!/f^[8p'%-py-*{P.o1j/>.s+:%q˳w, K55\I}1&QQvd̉Èyz,UhI~ysd/^k"g5q!ei8J$|'G^Om#ZDMϫ~z/CBZ$Г"]|P*:wϑeF!6 E.sob iѮ i^pB'A%}=m ~~?_Wޞ-JM3fSK`wTRȝ>{FU mީ]UhTUl;?s$GVbI0䙈[^[͢1# cyoXnDOgͩa64Dd=@]eT[#>|)-f2}6X^OFO!fp 6 ;%bZW~:ؗ~ޣ }pBp(ax 2O `쉭ArDf¥lV LTgo[#)F EzeNyX ?~:lE;MEr_ V F@`B_] u %%f^d]>~UL&ncS`C{ m Tb61LVT`P|PHWi/A+ ,fJ!Ofkg*0B )cٕ8CFa@3S zWvmjAa5 SehUIDV͒Pǵ* ܝ&Q#`{(m;Sљ }Cݫ!_vt*$L;l/fsDX 5EP%q)="ɠӕ$-IH}9$O681à 2JHqc1*.[Q( FLdjFqmQѸ)e8U]' bMk/}c4j>Aǃ?HHDnRL-oBTߒ \QHaY}f45nL-;o`y cp 쩊aKօQ\抯F|Sʙ+r}/Ly#fs;g*%tqA0q\^V\ws#>Zf{Ur0+;z:#FΕcζ?? ?RԁSCzF!5h8کlp}ƊX ve i_zg<n8.?40H{]",E#D,zS)){5g&j7B-ݫ^;ń?]r&rsei "^4sKMWi5SkVf J ".Vzc2ے`s$p]Q\+K+hg>^]"~3gxۗj\χURV9( 'MT(\6s\ Ib7HgH,~39ӛf]$>vGτ@Ʃ " WGW,\Cpq̒'u@x by rbG=}EϘC9u]lAȗ,4i?B, vڸ' [ {"u,{H U}'J-Qzҹ^)w }OerXO:0.E7يRm@RܬcT؃zZ".x8:ҚEw.ُ|$чS1m>y^M6\Lui)%r)}Լj*ph "e;DMjcП#A`LJq)s&iܡU+| (5 /oMjc5BD,`?uzg QT\:b߳7۟jĈѶO;ۗU^iO+>O_f6qc)wr$t09Y?>z֒%R)OU@'[J9--_V&HJov Vɺ 95y3* N=o|ס0u?LHLRȾ5%sƙ.)L7pjR̘vv7!Bԟ:|dFP)COݭ?&G 705ᓓUt@1RH Pvp"fp|UEE{F)@撔/)_ʺGxnRr:!jU4YHE؄.MGj[Sp y)"T4Gш|NGomW GBơ(Z]/x8ۃMKF.njukwT3&Q+DjU_4X{/n]#,sp҉~4 >".Q?k>CM]'Ckz'UQþGhNU#v5ck^S$A썀~` yC*`Xݥ6/6pXZgLܐڋKq!h5ږ hLujxƧ{% !βRE wp׼eCw/&Np#˽QXtOUPO87]țT PHoe(apch 0& ۔zRgU۵<1[>il5`Jn\.HL7 A-AMƴv^B0R{8UR2[`,ʝ,RH&iQX*dC 0***T®؋AC%ZZHMߎ, LFrW-zUB6_Ol ;B0^Z 2[zP[ p?Aښ0b%ϵ'psV샰zD53kD2oB$cErݦ$y)j>(#5 j}b 9DGb~ݷPh˟oJ"9?r⌑aHFKĐ<˃$FӞDʿdjKY*J/\V /yQ2f`G dO ڵB5wLݽ&W>`:Y&Q+]CQ0y Km, k6fGC~ry{*э(? FMT Wyj4{}KPzpp)QgKFDh܁t3;J#'8A9e=MFʗqIP1#2,M; 䔝 ;O+W@$fGd]G." Q-  Q\H+.+.UKF'>Z3|UH(7/Sr@įh_LER%SfJim,'zD!7;& Yv>Sjozx% ,jD%1}jq&H>6X.c7<&NHqt&覣1ؤE@e"2Ī{tSGHE[5FIbŷp,Blu7Hy:yPxkvcvr$sţLd{l0|X=k?Ã&GؠNFC3\(eccմ ,,uz+F3T_k*#@)P}#g'ХhglF;IuOZ"ǝBI'/ODgۄxbϢ=>z}ЛJ]nQQBe:P[t\yenΆSA ߐMJX3#QaljpGDmQY"I @+B2FIIK$w(4 fȜI+-g. 3AmJFpNz,|i;h=َ nf1`8N9!6;vT'6Hd v7.ZӁ.aZUuY+#פ/2xr1aWs\'̇]BǖfFqf3\Aٟ_&fđeyMЄ9@٪ "wSF4/RV Қ~"JuW:ʚS97 U!]'&fYl?[B!Z<ٯhW u$c2ea_~D@zmn2}9(07ŭ3F{P] jגoq;䌗y=l߂ǜP+^N>YbJ Iڂ`fxU(ty5B6t Տj"# 5v%mG `Gdf8ɄW(q%SHA>kRh5 _Y7w+m`?$4~+d&ED+(<?:UFxgYmz +dA4{_Hz|FTct8 f|Kx #OZBŢNBQF #am.pw/_'8 !<zDJI|*K߀sLnކ7ک7 E"O泔ƾJxɹz"ق9Ry&ؽ+PUkSq!Zy5 $_n؞**tA?(ƢQY1l: c';./LK+L&PM9s.+nnDs'腱5y9t}?Sz NAQ+|7hW7ˤ S$WT?d2}T2;moƜg߾2 s$/؏m-P \3jf( + {'mZ8u3?H|q:~'Y~Jg-Ѳvow38}5oƪ78ڏyYzMU_F$jys(=z(&o> 'ooc%hI 5Ps2EPS~04%o;7,W"wo.ꯊNaonyvs]mxqv\N2 2KG{,WQzԭŗq +f_%^}sTQw3a a]D(7"~}ZS}jT:=61f,iFhQE^Vct݃ rD5P8|"б.v(*bԙrzITLOح.kaKDME]=ʷv%ٓw{'dsu~1EPjbQ UG$Nk ,ȴXǟL sӄË᾵)]myId-\d!9 1&L+Z'tEp⍒^)ݙᓔ7N*V.i3+?urtgSYZրeb:ki)`V@PmW'A9b*ZL-T/o,XӍCKa2i^ w' 2ݞk5A2j0Yڟ+7D0 9?ҳjE&ҢHX8]gAQG{3iR`'aA)<[L̸˨+A>%p4Mo!̓c8 =W8v;H+CjHà R-S?O/JyuVl/fS Ucvg`1)L/Qi@|6SH jcծ7Նo2U:4,=/Db~z(;*A F ?(1Xl^^3I{Up_mc! WZ}fOE%EYN靵l[WJ ^u$+.$9 ܥth✭}t3mw|sju6C *X/,%/hLD؜ELt#>}$ܬ`CoHY@mFb[ξ6J2 `ڻ W`pܕݒ;^ f/kߋ(瘹.^~l-4u^a}$nbڲt_S1R0M^=ڧ(F} ז7 _9͸%2,p}^g_)>;9>5q~ dǶazPrhDmr,1-XʁbCgٴ*Dѐ&kZq[yb曕D~Yn8O7QKʙ#uO ʄJr <Ŗ.wE1l&$=CnУ1"xUchWAW"OBux?aȧDi1:^#РsEgӋQ[1W2;_xnGR20zQI&$+fQ88'HBT">b-:c]털l)R%14ķ/A8y{IqHP(7)S][Z/y6}V[[guK4r3HOO\xИsYOv{A3@)lE7ϩ탪*j< oFv_91HW$Yad2sND}&+zKٲ=ɞ$1\DFI9FOltso[D|L?_k-ru[tmz;ܹe~.TiK3,}OƄrHRmBjL-i"蒧eQpS%DE]ס?eVEn0c.ǵSer}F"6X'Kߓ) M2X()HѨ7+G ׀,mkrGRTQ,.#\#LSL~{c%ݜc(8yuvydx7 ¦T_ HK7F/%q@Phr[%tnYgض)fqORf1YD? mvP}8{Q3l<̭i${ #M0n<sN[8IN`ۯ< Q8QT3\0dygB73dO; 2em?n0Kfά7jI[]g -@*x?Z#52Naϕ]4{ EF6}GkaIrY) B$Y݃a9By 3\h+S5b@&]BɅeπXlS6^5Ղim紛nK]aIKٚ6ĨiXD c֒I>eF?t81)bǘ5a$"85dV't=bI4ɧnN013sȬIm" 5: ͕(JU֨h|ȋeN)7U }zH@\< 𹡹e#̧f9@j[Y8z؍)w@~@OKW3rK8 R`WC^"GmO+e,gSD_"p^AOVK*e?+Sv&Ea^g&qs&5B͚uxR>d}.R, (vB͝5 NVudhg/Rn-B1؋;lL*^]!.ΰ7O9H}$|hYlsA+d?Rt*/{_ pıXlSh\B] e_bA'=-@'W:n9ԓ((KϋxoD4m.{2Yw\7;M[J_R*.dmpvqefU¯MW4QNV'R R SN͊||%Ԓ6W~#,fbK?g@*#h$U+Y#YSkR"G EJ' ƹw,VöMOdkڹ-MZt5jexR`tJ 3ȑ(_g߂Ahi|} t@[*uaCզv1dZtm=1 k86wud6#p|5'mY/cAn!߂~B[q[{unp形QÊt2,t':`G7xv;SBKtuh?[2d1 ܓjX]N?K*os|X .3sBz ?{QT_i}՚=P8HW!J 1ؐG{o k]+fzܫ}_ =ٕGyJ``!]IgSiU6v{o6>rb3gA K{[3{UmƮHi$=y]z!՗W` c}14Q~J!d qPeQJ3h\]Ey$qDJ^Mo1D 9Sʆf@r~ Gd1WEaι*X:ؿ{ߨ4G{Ç~WsjAqXD=]TC笪uc!\[18,Ww*!I!ZO:J"F&@gι冚!UQzj7σ|9.oՃYy;vn"l$jk$`3*9J{N9&ȗ[E ^B$67 ?c.n 돍$AI`:_*f(Qt;H8k[|=Rش|Rj;|/+ F*h s^Tp} }{>Κ\fUne&u_.b9'g&KBT/ Qr}jٽJ7[/sXzL.Yqٰ8ڻDž6K8Q!na2YX |cN MwWXUN7U@<H=%[ɅNM&ȵ+r+zr6O`3H96_|\l !JK!8&"ַ`P=6s2zlxrơ2obTaL`EsOVtnjԝjx.D^<З B)Uܵ+YRЛr{\!WNFwRUKkq zYajdfE3ync&džV 38;펽HM zʝ+l(߈q _w21䊃Jt퇆vDX4b9d<ϹZ>:k=Yvq'!n)7̭U,Ċ0K%_=#UR4\|FX Ry$|;Iju}ʮֈg@cs ڧU r Blm˃( V5e[|w^V<O"n2:I2DJHtO82Q4ІV$V%DYS]9؜"ds_QNVK[)`E+XF>$cum0.7 _vxh{(wI}.x"凛^hfA w/ ʠP^o6Q5M.Y{,܃8+CmVb`MF'R;<[Zl8ӬV;B5()5ypлc-ʿmP$>l"eK۴!d-HFڳ>Ϭzx5.2:~OUmɣvfѣHcۃ&fhN Oô ׋_#q hY-=#'ZIP3;/6t{kչ ^Y692H)$SPiN^vPLs΀f')kpFg}Nj#`{:zpZwW%Pօ%h Ju2tr =4wBUްs`TD#g#G"Fԙ97ԏb7KA PW2CJw@5xq`څ 8)f*[forʛQO&KL E#ʶ(LY"R 2F`^>")5>S3uk_K#eR:]P|;jx#槕2'׉&1kUnj|@sv:1aY2ڣs&Gz L  ~H@pB(Ҥ)(+ ŋ̹6Bƴ\.F[MƲk`/HڧNgx iƕ\^,\*`FX P0RH\%d/DEAPϱ5N` ΃i -RRL'G/F>|eV%ukW1W`MbhS՟sqo9:|k\#{|:0YXS (bc8Xuch,@4 _!:x-&@5CKB:?J㎗@>MDb]AaN{.(wt׷R* ـB>s.GUP8&QsqG@h`05Ru4Lj'3)4P[@ex//uHi# X==UUTU;.4n s1]2>! Y#1{c#s>'f(ntTmP=]ߡJT[% +\+)q5cGV(/>P1^<@ƶky"~r_9wpSŴVjHcMUf}4CйxnB =6nJh0qH5LU7eo'&?SQ*_g_hAׁ-9%U#p~RfdffRTr=8Wv+KRw~+` v`乺֣Wh.鶑"ʳ#':t^\caԶ)+HzOԘ?|Es@e[oF8%_:"{UVsa6~ajxKU7|6@a#},H>i q`zC #n9f,6GQ!O֭OG}J9J+]\+jmǝe@#p$GԥG1dBx A45^~RӑOxKM`^`Bkv:'dmHJ5ݸv}A-]WÅg"_q'Si/N3eKOopj#-riÃBl(T hȥϥ iWV)%X Ujn\n7HۨA=.<=g 5۳huHQAH9~ 񣺶77)SEdgs*>'J5欔kH'{)$+aj(|jHzY#?U;l3r4>Rru2UXuլ E%!+Ɓƀ"8C'r*7\A$&&Tf?2Q`#{~({ͥ|FoLyA$ſx':Erj;삷]}%<-7*=Q$F_5y$AhV]'j_t[?uDq0(clchRgCE27j\`OodLzNfR5khNE>f:@Z<PsWaP`'@rHP|bdlt<ܵ6V'+ Q"fp{ޫ7l v>^vF1BrH?#-1K)]yyMN:bSqS|S(Lnf8d/b\New9-km6 "fԜ_~fh @I&v3vsw=㾵2 Q TP.4p.,KmVh2=>J]=ȥ˷#P pwsRtlĖ%2"9xf[6,Tw5@ϘOO"<\rJ6coQE9<;ϻX/1`韨A8a^hش(.N }W*YoUo)VxGu#lSv){Qpd\ J]AZ@Z)ڇul=)RcvOyf>n [R35?1BGV~1`ppg9Xw3!?W]#QO9D'@^Hf?vw3E],}?RClzk sm8!1wМũGŋ2<*,~ui MBj"k\=(9=Ls-"B,Lebn֘q?GQe>Vnj( d_}ɞq>#@ *["pV̑K~~%}iTYBS@߀&'ghr?lﶲ 4KjI*s;P,sA^h;d5Bn5*Ό!=X^Pե.kδrfNŵ]hh1΍-:}ka]r_AFŃYQg؜2 t4AFuq)f{~,&=!a*[4"_]xX+Ǖ͖6p*#j6?RԺjHM1,(GBo@4WRjTY~UIT`-q'<1@ވ>r'u#Tiev-֪0y92Qd/̷dV`; #r lݠ[H3ToQأCo {xP&B06H;OE1i7 h,>*T/|o>s˜,N~_섺m4MQAT P+m:ap=$s2/;`f|yW6fT/;fG`U{ ^ UMs]SB,mW}wYG5n]%WӇS;*\4FZhlpUkx;`:WqՊ^zR^RrXܭֿ"a݄qXX(}6Z|]QٔC^mN^trbLR!k xm&ͺ?C?D)ݟ^8_Oz nYYŲM_ZpzujL)Y~ofb.,J!Ui[kxXɚ#h6;$P4dgǨL,NJ]ʪdf\P9_k'ɋNTZRvth$h_bAf7jvU򽜤`_AC&!c{So}lOʦny 姮0`S`Pa%*#xkŨ:yڸSHlD1ѷ'8Oۿϭߞz 2~~A/qzƥkfbꮒ&\#)4j8/A8ޫ*#V' ^z+"[ur)-$ h cJ D\(`J_ĖL[ylN:TQb (2k#QKeOp?\)j:f䳪wC)_Ϝ1𝩕9\8lMC|:?NGC=%?E{Va-AeA|o&5Ld;C4Q8@0Uȗ+Cf#qoa"͘Z?sǪ6asKu2R jt+r aJSRH W cTy24\IC"fMKɝ8Sr6tyl} vSS0 $Arziڲ@ ]W6Qvc^vO#!&v!j(fkQaxlw' x)o- f-%ƾ28MW4> srGat0z$%y&z<pNUg72{w<c|:n-߄l`ptL!V%>,i~>g*]DkpSvI4 KďcDVJ2}6SqI2!oCZ%#ϠC쓲,zsH֡J7F g͠q74[~ף x ŇEګĄjx2?W)uil@5,wYi8Y0ªuK@WN~ph% ;q~Y-N>0Q/d2z6 oP2#xI|^QG&ydI84342@<J.*g f҇MSy.LO7cTSF/\jc=3/<ӿP[EOmX?v2A\Qr`uzĸwgJv=H+{E+]FǬKC~%[tvoel~* r[3:L 7t8'U뮃EwnTdPiwG,p C5xv}]oD鈰KVV V Jf_nŽ}ѐf׊w"[X]-EO01&ɥP/azLϬ1sv<w'm(p[e:|P''nBG3ed3̩KHrP귂u)cN˓lG`wcТ?=1[zhӷ4*c]x20Xx0F\q6d Pb#ga" }gH4D<Ϟ(y>Q@P&z0_\jA5hfD0O霾qOlgu8ɐz4k2T!\LزXXAvqu `dvKq pE̥/C-Y 'Z4*?>0w}kyB`jY& Tr0NWUSfa[P A׫Jw-̮`dTj]A {;Gڄߢl( >mTǝµ3?3΃7ocR13$$wbWԞhu m!C3Ц ̟_7 za}m-uy>qÖQhUݫ\ƑS|Af<6n@s>6dXA@ȱR8Z1M h*𪵐⪼,*ؙ̯06j/v~RprS 3dM__"%+~zoɷ 8@vl>1`-w%SRlaxxVhtᗻ®[ 0>6|nfs (_j/ ڗeΙEQ=UХ#L Y^8:@R#H%ŧvCjG+88E QبOWiqge ܥ9=m1.,P-!nJR_@Y EkU[zMfUx.6^Uw@ge ? '}I_̶h0$>dzI}uU=oo1, rwk< lV9o~ ^-@i*]#>y竢krܜ4:6T/a#yA1:nQ_`+9T\zp mB(ؐ}J ]c{o8es@5a]p\$60{'F0i9Tq%D +6b]'Hi?nAOLE'4idc7s[ ƒ)s/\rF28 L7j0vOP\,e&ߚ3Za9R]EkLYEVJh.f$[ cIpB#f4RzKџO@Z y^xӒ2&ə#CX*즌HG=W+OZ)o4ۡ$ɐbӉ @nh.ځH UObQLs^2'( (cI盦CQ>uy,ׇ.W>aʨi.~ڰ<2y,r=mp4R͉"U 6iDKԣrASq3&ޜMԀpވwdžt)#1Ք`WL9܁tqKq<f?ڋ X"DWL*t 2*e; v=@9"F%\Xh tֽl^."De8[y%ٝYzq.&4ScHlޱ'LlO(iL;ٓ)‡ڥ2rX()w T o4kH-J-zsBmLrd!;lR plpӵtя˜ъ(fWWVY6-DE2ۮ6'䭡Stէvi F|~l'(l1'KĹ+F-ώ 5^! 氏BBVX"G=P{)IYVS bK'SWlߚ &O|T@W;^ٕ7ǀYJVk:d]M,9q)5\_ #%c!0)NRJwbX\H);w"vm&+\KDj )pu:zʋ2|WG`3}Onwtn`rD9N!9v 4`7Da$hS9L#ρ ,^q{891>T̡kaC6P7ln/IPT@LQgJo9j4кcUICވNsOqbQL2]sdD%JH Nnn0(0lZgOMWF 7◧anSS۵#xpŒs5;]A[&8@ـcQ_ߣEf`¤4 TU?l &D8|Cs (?mm؇+o}ħK 1 4so b3B <1=+tI3S~P/ ˅ YhCqI9%P®H\-*MQ 3LğZIBtۜNa7=?wX(>N,c@TсW}Z%5jL,@q%9Zǒ!i_/Cf@m2jdih;vb붔7[0A? `R0qF,lKK:Nʧed׊rʛ)FGQ{)XvH`as! ELd̝2BHm5,$j@wl#f+^ P7\uLdvF3ᐁt_Eȗ> r5q E7'9! " bY\AVf[鍐A #|4]x"= +tRL{oLgH-o`z\%>wyx pρhg0w@PETH Q# 9iODHZ I:nkb}ito j̮MS6R'm"8H`ϴ6Eͪ(a6$M-f?&g|1_&@΍П*AJ'#z3\p;nK9۵_*g)먖t q\>4?saNWSwқ,L>yg|(ӝȊxʅ/WМ<͑ Pp'{nI̿\tf({Q|p4BZ~7Zi|QA>Y#z _\8.a▩+&@!t,/^NENO -!#mgT:jWe>VGi{M=feX^q| lE!TIV%꫹z٢~a=#&_q'^Moq2TrHw>1FM3)Orb$zXx)P=0X؍ b.A{J11qesv)dU)#ɃiI4 _Rgqt.m: 4Ֆ|c X[N8 9D™ ΫfT'<̌ϢJ81Z4E9aLڠj}$jR,j̇ʨc-3s+RL7\o96$oJ<CH= p}ZmtG W[NqxU3q QXt?k~Yk f#ZϐBkf̱#YmFn_;SY|NG[Dm1ÌFP90 Ibf(ot'ʻHX.\aKoD< Um1*(+мh0lO_tȦюL#bB`bղ{3_ 4EIx'*`k%Q\D4(W`᩽2Սi(T ~}~,E'P1df& =lh$~@̚a䚫't:).wҗxW+U%>~N!̐5t $n@R%4S{-M!$+N!RUO-TX;Dc/;箏PO!>@n}/h-6Lq% %R fC)eyuYmSJom!> &gUׅ7%Nll oвSneny~ʝ_y^!i\  Ye*p)B;[${h$Ny R"a_fإv%ab@N%Ŧ!H35.Rt <Վ!/BJ ZIWQϝz#A.v}cXyj5O4b<2HŎs:6/Wts\}vn|86Ju홧 TK(*wTcēsk[3q*=ҵ,Y;w͜ S_N؁țINL)r%n93+ߛ`~TK'Et2y+*?ahu_NxY(lAZ' HWvO|u$d,nٱ?9OC )!JQI[e3Fy>RSNW&0y_gpKb#k6tyZbܼYu/ΆWVv<~'0&k*i]`yxm8VqO[*,{Y >:z""vwB+G1urM]Ìj|Ha}eveME-iuaiJfW Hp|f ՆZ̯/,y>{;D z8Gzr&94t$t'}؃Ov l"T P:s%]@:J{m[ːUeҍ >"iik762p4h=aw_LR=] ;IDA9^: =!*|݅Q" )܄02'9l3JnvHeEr@@n4teͱ-Xc5cjlo뇼`oj/"ؽvɓPq8B~cvTJ ݤl»l3 DvNPa6Oճ}0vL.*dw+jDgR :sWfa Z}ID gu ^`Y Av}V9XYeK VOO5cd4^4d- #xf!wpB'ڦ|nEcZ3mJ O1z/3Ws֍g x ]}d ʺ@xjV-'K@XK:$n&kQ2px#p5NE ֬ LXhDCX6 74 >]9!ϵ3[M[]c4چ'm~s73qJJHxYaGc{dTY[.N=N͑{/מf)>JJSE &z=]ǻZ+Ƞ61M0NԦxo@| C @vL3Njg~)S2FfJe(w`=ҕ~Dl*},'2x qMCZ$(l<hrj:;jK%H "oWMͺK{d/(#m,jv>l^){F%zOz-hs޿szP> z wC#Jr zm jA8}8Uy_ҷ[K?^P[ɣ  ! TcDYp*a8 ȣI`$ Rm.q{#jb9ziҪZ4:Mw'wӓf=y&h'/ if sޅXo,!L.KGi KI ŪHco0J!kq|f2ql'>M%)ΌӴJ73H 7cVbAbX,s_Sxу#1E(`A%o_!53ntjk)FN*FOmG# O5p$@)ycɇrjD1{VLo5 K DW[ojmmд]Y-WaP)A@k$~y݅Y@0؁rQC T?첪]e[L?` (_A:W)~zmU\q3E]}Bre3#r5Pb%k*Q Dttfc6z{@z\/':i4N58q¬̬K{& 8fGuT+QxtQ~v-;)ek.#@nQ@"?˜ݑc yg~{Xd.-"igeWaL2Z(~ͼCZW2C| a}ݹe FAaf ,DP:`OVUf6ۤ LUՃ*`*um ݐX&$eԴt2aHT LKck{1N/cQ%ReT)ݜLgQ[ FN!(L\Z.<} kxy7RIADd"_ʽLNs %S=u%ڱP2u z <X틳դZX7xgZN~QϘt 1]vTi?<EؿGۙ ̉f.aS~%!{@4(Pq44|ӹ2THȦdgNFfxGݥ,]秲DSXD=[p)l?T8A#|Rg24W;`lMƅ[?i> |-*gRZ✔n-. Qۻw|4$1ANOVֲiƚtBP4Lej7ֳ5?/049)#G5 ]D1uu6YNi#b\Oz)^3((¤~=#`NW@I3T2RHTQx>-U`qH+R,9-~qPfxDZ=gQ>jumO^FKk>f6W, }Xld/LE$D%fsi5,$rIt]T8)`Gl ċST-4CUᮋ`v{2O?LYxb~m+0o##U"$qW_m(|'0b9( ?[U#r4VcL|k99,_ItxwƊd8amߟdU-$R2\fTOq@ۃ{P  (:!<-ݯgu_dS NZ1C0k+Xc{ Ϲ"6Ku z GwLo= ԩH'k?N5m#w r7aB&y8/uGڙWI#o|S9R@ȱ҂恭ȥ& B2u(8υxsel͛6O Hya͉v}h@ų3 . 4u}GϤtz\et>czGK3sy['5Fcp԰͆"Ce0ZP5ӂ̷ٚktu C.mU iD>wpq5'{5,lf k,ګQP",1tѵ؟e5WՉ*MZki&# >cqӖ<8*KB2s|#KAu2pKxJI1#D3϶#Q^-2=6:pfeA23VhԜZ!VXPHi]Ʌ[iFt] UktE%Ra@EQ"j&,- `C| &9Sq;4K$QDy"(x>6I@s0#9N:t 8QYh4vĭ+͵Ejl 8B'bmRs^@j[G=Д'D3% VKkZNZ,U72$O(з̩N_@{_ k}Lxlg޴ z9ȩl1uGKFŠ R1B2^PNȓ+# r%ͨ6)p{ΥuڼSS8U]]H88k,؇(FŎP2pET3R6@`zp4T< Ndhy4wm7AlQ*C B2*bv*k@,_R-}AS ԣ(]tCKa3NVpI^yk,rGdڨhnRyZj6>`j {^)\Xe`ߧP^vd \tGT?lEH72bɹ6;B4Xy%/g>Y!^2ЉMזoc7oMƓ㗿g<RM|q:Ӥ,UC]/d'z8׿͝BJ>,{{^ aH&8~A=xk =,ЀMp43]vv9W d^xrرuE[~erT{ο6`.:\v0fwC>Z}H SS6昝wiDt (Sw LJ%)h2PXROܹ|M fJZ~I 'AKMz'Y8yd` B,DO+93~pNFoB#$Lת"_=fkI-pJU׀bYIzy;¾~m 49nr'⁺-A`WcǧM9C+?m줆#qy7aΆp+WQUiʄ%3D J@ע̋={/F^L ܻl`==-8~31$P"Sn#o ǘ7QdpJaĩF9<!.k>unT7JZ&0 n(P1PeI! B0>g[̸?S6JqHENxk4Ya9 RrO9lvPnvېz|mXv Z|AMLw~ a+j5*"W5]6%N*QU/W9%ugʎ0I\M{ȃCf9qbvH#@eT"״2?,'+l0p %@5$`/_EѴ^߄4=oDsb!V< #nDø}ZRI؏Eگ~J:eK!aDjN7 cƊ2L#f^SeMmѐ% hX$ 07m1tWwO[yuY"Z؝ ^p!%rm?RF*yayb HeZ; [WaɊy>Ԕ63ђ>%܏Nϳdڱ!zG/@WC8Z9T> duV(Wk&Ĝ-̶O+pԫQG%UںHjߒ{Cܖpvpro4ri&1)vfS9j3Ă{UOU5oEIȄZ̀)(xj(U0le|Ԋr64IsƸa;Ȟȓ?+Vt{^PjiKK_T5b}ڴM MI޺{mpgO7"Yff s 7)l`5M&suJ 9j!.h5EUaW&J GOlPMN3Z5Gc+m}@v5>Uա5ebֻ$XLx# 8PL)@6yS|߸( wh'%.S:zL>1ws 2n՟Dzxq&%3q }>~f2>`ƪm/QitL*y~^NҋL>ƯCS!ӑ]l"CoUGyn,w]Dm P*ƹ8 s*UL#|X 5Xmؒm u?>idW> "ģȹ'٥$DZ̓&Fk9PWΧx=-(Tg7Wԗd5ݍg Jx:ʬ -_].*;QD}=!( VLVC@x@F{ hw PeKl "d|ld9j-SzG}_f3O-}4l(8Mc=H+u$`DŽ˴c0'{{,|1wΎ`c)u(Sv`2 6Ϩnڅ;x[ `Q0&֫Φ/{\fD0e2}" GH$ͫÈ2Cj0jv"pj%(aG!!na2nYK)^<臑id> TDc {ܬz<]nQBy{?Љ鈓)|}Iog6U7L|0U&Ez&p(4ֈ:@1)/n܈sYtFLM>tb>f+l#jܓ:O":9eoźD*]_a5:xt 6x:hqADޕg ?mQm/[6f&W( 3-+pr@ kxP{oS;.߹Éʕ,/]nC/+%w XWAT0- J+b*a,UH_Ur鷈e!ߢcо3[ùhl>,y75C:z"!JTD(rSH-U"?zdQv M7J֔ꖣ}l"". s+eBC7"d8Ɗ^Pq2f^ q6ӄzlA7glץy+ Vϭ~s.cARXbm ;uCⵉ>+wJoP ID/ BkM^y^!d&WÜd3?+S.L;?yHm?R*6B"o&ḭݡn]!HgI.BbRkT;E*R>7mؠVjW{Q{V"a`'^:k4mam*@&Mi/rCdDs"e5DPT0&9 nghB$v}. *r2Yp{w@Lx>~ ^c-'IԳ&=$e IaFDw{]I@PH WIЀy,~ŰO ~f촤ByXI Kㇳ Շ[T(a슝X^X[CZpz G-;)4Xw.ɑqH`Å}L['{x\8}:{?9`ic>J䔢 q9`N@wPdSYMOn ֻ֗cϬ^U5%ոyU&p .`Α΀x(#.N^!UY3mA׼f O3t|dk~~mD٘oO}.ݏiSS2!Sޕ_w >o*a]y__%*ӵ|'`u}:n7Pb~}[Q#r.By ^ȥW+c?rhdMs݃.lm7>i`g@{;j QOم4V] i`Ԡ`;ʑmǥkjN㜲_-6im`rrS{4XlK- Luc {W4NMX_%4l|5Ô Smӱ~*R5(I7,6+m4WOsvVPϠ<(:RCTP&4R:V9z%-pЬ4,PH$rMRO#9Tx lȹwKڶx׆zM& ta{(pQt;UaWhݝάmQ%UR!D!K}>j0!J"!1A uWcAU׫#hRcHD1 *mv@D'RTll) Rˤcض2?;weadf&bէ,ޓiQY2 /رE!S )2k'VcO+srg!1>\:P>mW)u9ht'ndGV(O8?~@[QVpr:A P5-Gf1ìA^0yK# 1 ak2(4'q(O^Z1H'o,L]ilıfr1>~I.vgsNM:\>k=)oܘ.; ,L1%ý*0|4~6 ,LiON۬^9I2Vg0uKG s<Oj>wN(WBN1==|bcHȝ4 TJȦ$,y4:J>a>q"Cs*술["zp*(1'n}>x??`$DXI-ZހHS_*tD(J4ϸݧW i?X]No~0!_?%rjLСB9`!B)>l(6K_j5}1I3o1RNvE%62` A[wE0^ˆGb5ÓEި_^ OK0(F_/UG#P Ϋ4Rg z6W4a3f24#6Fh탃dwPQ _ڼz!buͪi]aرꛖD9Y,g@G>D6 KR07cF#{5[᠏/QhQ'_eV0/..TA_P@~aOY2T0vH!H "/;otZr*PO$4T^.Bv]'פb϶AkA8\b4prԞ UMW5-˶RVݗup];lrk-{yN G]su?޶s* PMs1lÅ}6ayly%p$3քޙɾm]b8f0t_Σ >6הg%ٶtLIut9WId3Uf٣4wcfK%MZ-Ka0Pn,ʉW%UùJ{>8U@_rlj.MDk2~ g_ٖN;eeVX> wt9(2kP8{'b|OWױ~m Q^FTU ޘǤ\E* ^W˥y*z;KY((G*2 1 xByDAUWXÒ]@0ClL*.FQ2w`Yh>g=1r3 $$d՜gWd*U}XlhHåq3=)j!j㮧UW}^ ^coĀ偼 c!j8ڋ r,tujA=|z;76.ب>x'gc)*IjeqV}^4r%#ߙtqGFit 4ޟ<3jQQyG6MMN[u de^{\yndKׅ;iz!$ӗWqi0?긍~,v%; \t;y hwt¹JwUFM91Ubĥ%ŸPuطұ-Ij4@ 8)+ʆJm\tAmWwdC )F#j珗mx9ƻ˙N[E_픐7R~)@ sE1F@e4h"dcW+\KEZ'O8k`k^hE8=5є,ԆJ]a-0"q6!8{F1_I9w􈔨y00B\!X3v6 Zb 6PV9ÜrS̳v#Iܞ@r2c\fF{4f#­R+r5 MɘX,IX {vc- fމZa!ug5zq)ЎZ9x^rwk$؟SvJ5H%/eaKO8@Cbfu؍TUB̹$ +/\Nkx;yE9]K-[ƱYäyx Jj$+<6SӉߤbv$A_ߩ a7jA ?mt]j)& ZHyo0P(A Lr8=:LwBPlCgXr@_4LvpZGy%VW/u1>^`Zcw30[yzN=&vW-AoN9ZA~h^0?G䳓qQxNq<Z"-M 'ZIxPsJ’fJ8PO׮s@_ 4 w Nt xK5dW JOA ([Y5YBY%/+R8ک:hIhX懃Ӽ?Ҟ9lY=pg >pU))F>d0 {~ p4KNZ#ng86ť'y3`Jʒ%)Q0i=;7MAمafǥ 6+, Zҏ naX-zov1JۦNsbYj Sf_:`SD7L`>0 YZ07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!#.[n9>SDvv2q ̎Ⱦ] YZ