kernel-64k-modules-partner-6.14.6-400.asahi.el9@>0     3!Iͩ\d:÷(Uފ<hM leif.linux@gmail.com Uފ<eOutO  tNk*W9cnM%u 1e6a1ca46c5a53c74586625569db63ea12945e8f66247ff39c1310fcabc35852cf44d0ded65b3b2a91b3dccf051491367eb52f06 RlI>9?)d$ 2 [ 06>oc,c "c +c =Dc Bgc FcXXcnGc6\c 0 T  (8F9F:F>@GcH$cIcX YD \c]0c^Nbdefltcucv wpcxcy؈ؘ؜آCkernel-64k-modules-partner6.14.6400.asahi.el9Extra kernel modules to match the kernelThis package provides kernel modules for the kernel package for Red Hat partners usage.h<6rpm_builderDf((GPL-2.0-only WITH Linux-syscall-note) OR BSD-2-Clause) AND ((GPL-2.0-only WITH Linux-syscall-note) OR BSD-3-Clause) AND ((GPL-2.0-only WITH Linux-syscall-note) OR CDDL-1.0) AND ((GPL-2.0-only WITH Linux-syscall-note) OR Linux-OpenIB) AND ((GPL-2.0-only WITH Linux-syscall-note) OR MIT) AND ((GPL-2.0-or-later WITH Linux-syscall-note) OR BSD-3-Clause) AND ((GPL-2.0-or-later WITH Linux-syscall-note) OR MIT) AND 0BSD AND BSD-2-Clause AND (BSD-2-Clause OR Apache-2.0) AND BSD-3-Clause AND BSD-3-Clause-Clear AND CC0-1.0 AND GFDL-1.1-no-invariants-or-later AND GPL-1.0-or-later AND (GPL-1.0-or-later OR BSD-3-Clause) AND (GPL-1.0-or-later WITH Linux-syscall-note) AND GPL-2.0-only AND (GPL-2.0-only OR Apache-2.0) AND (GPL-2.0-only OR BSD-2-Clause) AND (GPL-2.0-only OR BSD-3-Clause) AND (GPL-2.0-only OR CDDL-1.0) AND (GPL-2.0-only OR GFDL-1.1-no-invariants-or-later) AND (GPL-2.0-only OR GFDL-1.2-no-invariants-only) AND (GPL-2.0-only WITH Linux-syscall-note) AND GPL-2.0-or-later AND (GPL-2.0-or-later OR BSD-2-Clause) AND (GPL-2.0-or-later OR BSD-3-Clause) AND (GPL-2.0-or-later OR CC-BY-4.0) AND (GPL-2.0-or-later WITH GCC-exception-2.0) AND (GPL-2.0-or-later WITH Linux-syscall-note) AND ISC AND LGPL-2.0-or-later AND (LGPL-2.0-or-later OR BSD-2-Clause) AND (LGPL-2.0-or-later WITH Linux-syscall-note) AND LGPL-2.1-only AND (LGPL-2.1-only OR BSD-2-Clause) AND (LGPL-2.1-only WITH Linux-syscall-note) AND LGPL-2.1-or-later AND (LGPL-2.1-or-later WITH Linux-syscall-note) AND (Linux-OpenIB OR GPL-2.0-only) AND (Linux-OpenIB OR GPL-2.0-only OR BSD-2-Clause) AND Linux-man-pages-copyleft AND MIT AND (MIT OR Apache-2.0) AND (MIT OR GPL-2.0-only) AND (MIT OR GPL-2.0-or-later) AND (MIT OR LGPL-2.1-only) AND (MPL-1.1 OR GPL-2.0-only) AND (X11 OR GPL-2.0-only) AND (X11 OR GPL-2.0-or-later) AND Zlib AND (copyleft-next-0.3.1 OR GPL-2.0-or-later)System Environment/Kernelhttps://www.kernel.org/linuxaarch64/sbin/depmod -a 6.14.6-400.asahi.el9.aarch64+64k/sbin/depmod -a 6.14.6-400.asahi.el9.aarch64+64krx[|AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA큤h [6.14.6-400.asahi]Augusto Caringi [6.14.6-0]Justin M. Forbes [6.14.5-0]Justin M. Forbes [6.14.4-0]Justin M. Forbes [6.14.3-0]Justin M. Forbes [6.14.2-0]Justin M. Forbes [6.14.1-0]Justin M. Forbes [6.14.0-1]Fedora Kernel Team [6.14.0-62]Fedora Kernel Team [6.14.0-0.rc7.586de92313fc.61]Fedora Kernel Team [6.14.0-0.rc7.88d324e69ea9.60]Fedora Kernel Team [6.14.0-0.rc7.b3ee1e460951.59]Fedora Kernel Team [6.14.0-0.rc7.a7f2e10ecd8f.58]Fedora Kernel Team [6.14.0-0.rc7.81e4f8d68c66.57]Fedora Kernel Team [6.14.0-0.rc7.76b6905c11fd.56]Fedora Kernel Team [6.14.0-0.rc7.55]Fedora Kernel Team [6.14.0-0.rc6.cb82ca153949.54]Fedora Kernel Team [6.14.0-0.rc6.3571e8b091f4.53]Fedora Kernel Team [6.14.0-0.rc6.695caca9345a.52]Fedora Kernel Team [6.14.0-0.rc6.b7f94fcf5546.51]Fedora Kernel Team [6.14.0-0.rc6.0fed89a961ea.50]Fedora Kernel Team [6.14.0-0.rc6.4d872d51bc9d.49]Fedora Kernel Team [6.14.0-0.rc6.48]Fedora Kernel Team [6.14.0-0.rc5.2a520073e74f.47]Fedora Kernel Team [6.14.0-0.rc5.00a7d39898c8.46]Fedora Kernel Team [6.14.0-0.rc5.848e07631744.45]Fedora Kernel Team [6.14.0-0.rc5.48a5eed9ad58.44]Fedora Kernel Team [6.14.0-0.rc5.99fa936e8e4f.43]Fedora Kernel Team [6.14.0-0.rc5.42]Fedora Kernel Team [6.14.0-0.rc4.ece144f151ac.41]Fedora Kernel Team [6.14.0-0.rc4.03d38806a902.40]Fedora Kernel Team [6.14.0-0.rc4.76544811c850.39]Fedora Kernel Team [6.14.0-0.rc4.dd83757f6e68.38]Fedora Kernel Team [6.14.0-0.rc4.ac9c34d1e45a.37]Fedora Kernel Team [6.14.0-0.rc4.36]Fedora Kernel Team [6.14.0-0.rc4.35]Fedora Kernel Team [6.14.0-0.rc3.27102b38b8ca.34]Fedora Kernel Team [6.14.0-0.rc3.ff202c5028a1.33]Fedora Kernel Team [6.14.0-0.rc3.334426094588.32]Fedora Kernel Team [6.14.0-0.rc3.87a132e73910.31]Fedora Kernel Team [6.14.0-0.rc3.6537cfb395f3.30]Fedora Kernel Team [6.14.0-0.rc3.2408a807bfc3.29]Fedora Kernel Team [6.14.0-0.rc3.28]Fedora Kernel Team [6.14.0-0.rc2.ad1b832bf1cf.27]Fedora Kernel Team [6.14.0-0.rc2.7ff71e6d9239.26]Fedora Kernel Team [6.14.0-0.rc2.128c8f96eb86.25]Fedora Kernel Team [6.14.0-0.rc2.4dc1d1bec898.24]Fedora Kernel Team [6.14.0-0.rc2.09fbf3d50205.23]Fedora Kernel Team [6.14.0-0.rc2.febbc555cf0f.22]Fedora Kernel Team [6.14.0-0.rc2.21]Fedora Kernel Team [6.14.0-0.rc1.9946eaf552b1.20]Fedora Kernel Team [6.14.0-0.rc1.8f6629c004b1.19]Fedora Kernel Team [6.14.0-0.rc1.bb066fe812d6.18]Fedora Kernel Team [6.14.0-0.rc1.92514ef226f5.17]Fedora Kernel Team [6.14.0-0.rc1.5c8c229261f1.16]Fedora Kernel Team [6.14.0-0.rc1.0de63bb7d919.15]Fedora Kernel Team [6.14.0-0.rc1.14]Fedora Kernel Team [6.14.0-0.rc0.a86bf2283d2c.13]Fedora Kernel Team [6.14.0-0.rc0.60c828cf80c0.12]Fedora Kernel Team [6.14.0-0.rc0.69e858e0b8b2.11]Fedora Kernel Team [6.14.0-0.rc0.72deda0abee6.10]Fedora Kernel Team [6.14.0-0.rc0.05dbaf8dd8bf.9]Fedora Kernel Team [6.14.0-0.rc0.6d61a53dd6f5.8]Fedora Kernel Team [6.14.0-0.rc0.9c5968db9e62.7]Fedora Kernel Team [6.14.0-0.rc0.aa22f4da2a46.6]Fedora Kernel Team [6.14.0-0.rc0.aa22f4da2a46.5]Fedora Kernel Team [6.14.0-0.rc0.bc8198dc7ebc.4]Fedora Kernel Team [6.14.0-0.rc0.d0d106a2bd21.3]Fedora Kernel Team [6.14.0-0.rc0.c4b9570cfb63.2]Fedora Kernel Team [6.14.0-0.rc0.95ec54a420b8.62]- redhat: Conditionally disable libbpf_dynamic on (Janne Grunau) - fixup! media: apple: Add Apple ISP driver (Janne Grunau) - media: apple: isp: Support system sleep (Eileen Yoon) - media: apple: isp: Use a mutex instead of a spinlock for channels (Hector Martin) - media: apple: isp: implement ENUM_FRAMEINTERVALS trivially (Hector Martin) - media: apple: isp: Enable IMX364 sensor (Hector Martin) - media: apple: isp: Show camera presets even for unsupported sensors (Hector Martin) - media: apple: isp: Parse firmware version from device tree (Janne Grunau) - media: apple: isp: Use a more user-friendly device name (Hector Martin) - media: apple: isp: Option to use CMD_STOP (ifdeffed out) (Asahi Lina) - media: apple: isp: Only reset coproc when necessary, fix minor race (Asahi Lina) - media: apple: isp: VMap only what is necessary, remove redundant logging state bit (Asahi Lina) - media: apple: isp: Add a missing read barrier (possibly?) (Asahi Lina) - media: apple: isp: Clear IRQs when resetting coproc (Asahi Lina) - media: apple: isp: Rework meta surface handling & buffer return (Asahi Lina) - media: apple: isp: Use cached IOMMU mappings (Asahi Lina) - media: apple: isp: Zero out pages allocated to ISP (Asahi Lina) - media: apple: isp: Make sub-pmdomain handling explicit (Asahi Lina) - media: apple: isp: Minor changes to cam flow (Asahi Lina) - media: apple: isp: Add flicker_sensor_set cmd (Asahi Lina) - media: apple: isp: t8112 fixes... (Asahi Lina) - media: apple: isp: Limit maximal number of buffers (Janne Grunau) - media: apple: isp: t8112 HW config (Janne Grunau) - media: apple: isp: Use a second region for MBOX_IRQ_{DOORBELL,ACK} (Janne Grunau) - media: apple: isp: Make channel sends not interruptible (Asahi Lina) - media: apple: isp: Maybe fix some DMA ordering issues (Asahi Lina) - media: apple: isp: Add STOP and POWER_DOWN commands (Asahi Lina) - media: apple: isp: Implement posted commands (Asahi Lina) - media: apple: isp: Propagate EINTR from firmware loads (Asahi Lina) - media: apple: isp: Remove ioread/iowrite and stop doing raw address translation (Asahi Lina) - media: apple: isp: Switch to threaded IRQs (Asahi Lina) - media: apple: isp: Always enable singleplane API, make multiple a module param (Asahi Lina) - media: apple: isp: Working t602x and multiple formats and more fixes (Asahi Lina) - media: apple: isp: t602x hw config (Asahi Lina) - media: apple: isp: Support >32bit VAs for t602x (Asahi Lina) - media: apple: isp: fix copyright (Eileen Yoon) - media: apple: isp: alloc static surfaces only once (Eileen Yoon) - media: apple: isp: misc isp-fw.c improvements (Eileen Yoon) - media: apple: isp: rm old isp_resv struct (Eileen Yoon) - media: apple: isp: rm unused bootargs members (Eileen Yoon) - media: apple: isp: s/asc/coproc/ (Eileen Yoon) - media: apple: isp: wmb() before GPIO write (Eileen Yoon) - media: apple: isp: Don't use define for bootargs size (Eileen Yoon) - media: apple: isp: Better document info struct fields (Eileen Yoon) - media: apple: isp: Set platform_id in bootargs (Eileen Yoon) - media: apple: WIP: t6000 hax (Hector Martin) - media: apple: isp: Do not defer on failure to initialize DART (Hector Martin) - media: apple: isp: Drop the DART mirroring stuff (Hector Martin) - media: apple: isp: Split gpio/mbox MMIO range (Eileen Yoon) - media: apple: isp: Enable t6000 (Hector Martin) - media: apple: isp: Fixup shared region arg (Hector Martin) - media: apple: isp: Use preallocated heap (Hector Martin) - media: apple: isp: IMX558 initial support (Eileen Yoon) - media: apple: Add Apple ISP driver (Eileen Yoon) - drm: adp: Remove pointless irq_lock spin lock (Janne Grunau) - drm: adp: Enable vblank interrupts in crtc's .atomic_enable (Janne Grunau) - drm: adp: Handle drm_crtc_vblank_get() errors (Janne Grunau) - drm: adp: Use spin_lock_irqsave for drm device event_lock (Janne Grunau) - fixup! drm: adp: Add Apple Display Pipe driver (Janne Grunau) - MAINTAINERS: Add entries for Apple Z2 touchscreen driver (Sasha Finkelstein) - input: apple_z2: Add a driver for Apple Z2 touchscreens (Sasha Finkelstein) - dt-bindings: input: touchscreen: Add Z2 controller (Sasha Finkelstein) - drm: adp: Fix NULL vs IS_ERR() check in adp_plane_new() (Dan Carpenter) - MAINTAINERS: Add entries for touchbar display driver (Sasha Finkelstein) - drm: panel: Add a panel driver for the Summit display (Sasha Finkelstein) - drm: adp: Add Apple Display Pipe driver (Sasha Finkelstein) - dt-bindings: display: Add Apple pre-DCP display controller (Sasha Finkelstein) - arm64: cpufeature: Unify SCOPE_LOCAL_CPU early & late behavior (Asahi Lina) - KVM: arm64: Expose TSO capability to guests and context switch (Asahi Lina) - arm64: Implement Apple IMPDEF TSO memory model control (Hector Martin) - arm64: Introduce scaffolding to add ACTLR_EL1 to thread state (Hector Martin) - arm64: Implement PR_{GET,SET}_MEM_MODEL for always-TSO CPUs (Hector Martin) - prctl: Introduce PR_{SET,GET}_MEM_MODEL (Hector Martin) - rust: time: bind NSECS_PER_SEC (Alyssa Rosenzweig) - drm/asahi: crashdump: Clippy fixes (Asahi Lina) - drm/asahi: Hook up crashdump to devcoredump (Asahi Lina) - rust: devcoredump: Add devcoredump abstraction (Asahi Lina) - rust: uapi: Add ELF headers (Asahi Lina) - drm/asahi: use only a single run queue for drm-sched (Janne Grunau) - drm/asahi: Depend on DRM=y (Janne Grunau) - drm/asahi: workqueue: Access AsahiData via pdev.drvdata (Janne Grunau) - drm/asahi: queue: Access AsahiData via pdev.drvdata (Janne Grunau) - drm/asahi: mmu: Access AsahiData via pdev.drvdata (Janne Grunau) - drm/asahi: gpu: Access AsahiData via pdev.drvdata (Janne Grunau) - drm/asahi: Add AsahiData to the platform device drvdata (Janne Grunau) - drm/asahi: file: adapt to new DRM file/ioctl rust abstractions (Janne Grunau) - drm/asahi: driver: Port to dma_set_mask_and_coherent() from ml (Janne Grunau) - drm/asahi: regs: Update to upstream-ish io::IoMem (Janne Grunau) - drm/asahi: Adapt robust_isolation module parameter (Janne Grunau) - drm/asahi: Adapt initial_tvb_size module parameter (Janne Grunau) - drm/asahi: Adapt fault_control module parameter (Janne Grunau) - drm/asahi: Adapt debug_flags module parameter (Janne Grunau) - drm/asahi: Port to kernel::uaccess (Janne Grunau) - drm/asahi: pgtable: Fix missing nonglobal bit (Asahi Lina) - drm/asahi: regs: Clippy fixes (Asahi Lina) - drm/asahi: render: Clippy fixes (Asahi Lina) - drm/asahi: Get rid of util::div_ceil() (Asahi Lina) - drm/asahi: queue::compute: Clippy fixes (Asahi Lina) - drm/asahi: pgtable: Clippy fixes (Asahi Lina) - drm/asahi: object: Clippy fixes (Asahi Lina) - drm/asahi: microseq: Clippy fixes (Asahi Lina) - drm/asahi: mmu: Clippy fixes (Asahi Lina) - drm/asahi: mem: Clippy fixes (Asahi Lina) - drm/asahi: fw: Clippy fixes (Asahi Lina) - drm/asahi: float: Clippy fixes (Asahi Lina) - drm/asahi: File: Clippy fixes (Asahi Lina) - drm/asahi: event: Clippy fixes (Asahi Lina) - drm/asahi: channel: Clippy fixes (Asahi Lina) - drm/asahi: buffer: Clippy fixes (Asahi Lina) - drm/asahi: alloc: Clippy fixes (Asahi Lina) - drm/asahi: mmu: Use abstractions, drop bindings import (Asahi Lina) - drm/asahi: pgtable: Mark GPU entries as uncached (Asahi Lina) - drm/asahi: mmu: Preallocate page tables before sm_map() (Asahi Lina) - drm/asahi: gpu: Hook up crashdump generation (Asahi Lina) - drm/asahi: mmu: Wire up kernel AS dumper (Asahi Lina) - drm/asahi: crashdump: Add crash dumper module (Asahi Lina) - drm/asahi: pgtable: Add helpers for decoding PTE perms (Asahi Lina) - drm/asahi: pgtable: Add dumper (Asahi Lina) - drm/asahi: Depend on PAGE_SIZE_16KB (Asahi Lina) - drm/asahi: Implement ASAHI_BIND_SINGLE_PAGE (Asahi Lina) - drm/asahi: RiiR page tables (Asahi Lina) - drm/asahi: mmu: Add some barriers (Asahi Lina) - drm/asahi: debug: Add PgTable debug category (Asahi Lina) - drm: asahi: mmu: UAT change for rust page table rewrite (Asahi Lina) - drm/asahi: mmu: Change step_remap() to new api (Asahi Lina) - drm/asahi: mmu: Fix deadlock on remap ops (Asahi Lina) - drm/asahi: workqueue: Defer freeing the last completed work item (Asahi Lina) - drm/asahi: Update crashed() RTKit API (Asahi Lina) - drm/asahi: mmu: Fix 2x step_remap case (Asahi Lina) - drm/asahi: file: Reject gem_bind past the end of the object (Asahi Lina) - drm/asahi: mmu: Change step_remap() to new api (Asahi Lina) - drm/asahi: Map all reserved-regions as cached (Asahi Lina) - drm/asahi: Add the USER_TIMESTAMPS feature (Asahi Lina) - drm/asahi: Set a bit for internal non-render barriers on G14X (Asahi Lina) - drm/asahi: file: Add user_timestamp_frequency_hz to params (Asahi Lina) - drm/asahi: queue/render,compute: Plumb through timestamps extension (Asahi Lina) - drm/asahi: queue/render,compute: Handle cmdbuf size mismatches (Asahi Lina) - drm/asahi: fw, queue: Plumb through UserTimestamps -> TimestampPointers (Asahi Lina) - drm/asahi: queue: Plumb through objects XArray and add timestamp getter (Asahi Lina) - drm/asahi: fw, queue: Add UserTimestamp object to job structs (Asahi Lina) - drm/asahi: file: Implement ASAHI_GEM_BIND_OBJECT (Asahi Lina) - drm/asahi: gpu: Implement mapping timestamp buffers (Asahi Lina) - drm/asahi: util: Commend out unused len() method (Asahi Lina) - drm/asahi: gpu: Remove unused wait_for_poweroff() (Asahi Lina) - drm/asahi: workqueue: Restrict command objects to only job commands (Asahi Lina) - drm/asahi: alloc: Remove unused methods (Asahi Lina) - drm/asahi: Document timestamp ops better, refactor fields (Asahi Lina) - drm/asahi: gpu: Add a max object count garbage limit (Asahi Lina) - drm/asahi: alloc: Be more verbose about failures (Asahi Lina) - drm/asahi: gpu: Collect garbage for private/gpuro together (Asahi Lina) - drm/asahi: driver: Port to new device/driver registration (Janne Grunau) - drm/asahi: regs: Get device ref from platform dev (Janne Grunau) - drm/asahi: mmu: Move closer to rust of integration (Janne Grunau) - drm/asahi: gpu: Get resources directly through DRM pricate data (Janne Grunau) - drm/asahi: gpu: Force Box move with manual Box::into_inner() (Janne Grunau) - drm/asahi: Modify debug dev printk macros to avoid adding ".as_ref()" (Janne Grunau) - drm/asahi: Implement ASAHI_GET_TIME (Asahi Lina) - drm/asahi: Implement missing ASAHI_BIND_OP_UNBIND (Asahi Lina) - drm/asahi: Align kernel range to buffer::PAGE_SIZE (Asahi Lina) - drm/asahi: HACK: Disable compute preemption for now (Asahi Lina) - drm/asahi: Add robust_isolation kernel parameter (Asahi Lina) - drm/asahi: Clean up jobs in a workqueue (Asahi Lina) - drm/asahi: workqueue: Fix "Cannot submit, but queue is empty?" bug (Asahi Lina) - drm/asahi: workqueue,queue: More debug (Asahi Lina) - drm/asahi: event: Initialize stamps to different values (Asahi Lina) - drm/asahi: Handle channel errors (Asahi Lina) - drm/asahi: gpu: Show unknown field in timeouts (Asahi Lina) - drm/asahi: Fix event tracking when JobSubmission is dropped (Asahi Lina) - drm/asahi: Workqueue: Add more debug (Asahi Lina) - drm/asahi: Fix u32 mult overflow on large tilebufs/TPCs (Asahi Lina) - drm/asahi: Enable soft faults by default (Asahi Lina) - drm/asahi: Signal soft fault support to userspace (Asahi Lina) - drm/asahi: file: Update to newer VM_BIND API (Asahi Lina) - drm/asahi: workqueue: Tweak some debug logs (Asahi Lina) - drm/asahi: queue: Split into Queue and QueueInner (Asahi Lina) - drm/asahi: Implement GEM objects sharing a single DMA resv (Asahi Lina) - drm/asahi: mmu: Fix lockdep issues with GpuVm (Asahi Lina) - drm/asahi: Convert more ranges to Range<> (Asahi Lina) - drm/asahi: Move the unknown dummy page to the top of the address space (Asahi Lina) - drm/asahi: mmu: Convert to using Range (Asahi Lina) - drm/asahi: util: Add RangeExt helpers for Range (Asahi Lina) - drm/asahi: Refactor address types (Asahi Lina) - drm/asahi: Convert to GPUVM and implement more VM_BIND ops (Asahi Lina) - drm/asahi: Don't lock up when unmapping PTEs fails (Asahi Lina) - drm/asahi: microseq: Fix warnings (Asahi Lina) - drm/asahi: alloc: Do not allocate memory to free memory (Asahi Lina) - drm/asahi: Check command structure sizes (Asahi Lina) - drm/asahi: Identify and implement helper config register (Asahi Lina) - drm/asahi: compute: Allow no preemption flag (Asahi Lina) - drm/asahi: queue: Alocate the NotifierList as shared (Asahi Lina) - drm/asahi: workqueue: Work around ICE in Rust 1.74 (Asahi Lina) - drm/asahi: initdata: New init chain API for rebase (Hector Martin) - drm/asahi: render, buffer: Fix layered rendering on G13X (again) (Asahi Lina) - drm/asahi: render: Fix layered rendering on G14X (Asahi Lina) - drm/asahi: Fix Clippy complaints (Asahi Lina) - drm/asahi: Identify and allocate clustered layering metadata buf (Asahi Lina) - drm/asahi: Identify & add render VS spills flag (Asahi Lina) - drm/asahi: buffer: Complain more loudly about sync requests (Asahi Lina) - drm/asahi: render: Remove sync TVB growth support (Asahi Lina) - drm/asahi: file: Remove sync limit (Asahi Lina) - drm/asahi: Add verbose UAPI error reporting (Asahi Lina) - drm/asahi: queue: Quieten some debugs (Asahi Lina) - drm/asahi: render: Identify and set Z/S strides for layered rendering (Asahi Lina) - drm/asahi: fw,queue: Implement helper programs (Asahi Lina) - drm/asahi: render: Implement bindless samplers (Asahi Lina) - drm/asahi: compute: Implement bindless samplers (Asahi Lina) - drm/asahi: buffer,render: Identify and provide layer meta buf (Asahi Lina) - drm/asahi: workqueue: Tag GPU buf (Asahi Lina) - drm/asahi: render: Tag AuxFB (Asahi Lina) - drm/asahi: queue/compute: Tag preempt buf (Asahi Lina) - drm/asahi: initdata: Tag more arrays (Asahi Lina) - drm/asahi: buffer: Add tags to all the buffers (Asahi Lina) - drm/asahi: alloc: Use tag as the guard marker (Asahi Lina) - drm/asahi: alloc: Support tagging array allocs (Asahi Lina) - drm/asahi: Expose firmware version to userspace (Asahi Lina) - drm/asahi: hw/t602x: Increase meta/preempt sizes for G14D (Asahi Lina) - drm/asahi: gpu,hw: Fix array IOMappings (Asahi Lina) - drm/asahi: initdata: Fudge t3 calculation a bit (Asahi Lina) - drm/asahi: initdata,hw: Identify & set idle_off_standby_timer (Asahi Lina) - drm/asahi: initdata: Fixes for G14D (Asahi Lina) - drm/asahi: Increase recursion limit (Asahi Lina) - drm/asahi: Enable probing for t6022 (Asahi Lina) - drm/asahi: regs: Fix cluster count for G14D (Asahi Lina) - drm/asahi: hw.t602x: Fixes for t6022 (Asahi Lina) - drm/asahi: fw.channels: Add static assertions for message sizes (Asahi Lina) - drm/asahi: slotalloc: Allow initializing empty slots (Asahi Lina) - drm/asahi: initdata: Initialize GpuStatsFrag properly (Asahi Lina) - drm/asahi: render: Correct some values for G14 (Asahi Lina) - drm/asahi: hw/t8112: Make last IOMapping read-only (Asahi Lina) - drm/asahi: hw/t600x: Expand some mappings (Asahi Lina) - drm/asahi: fw/microseq: Document bits of has_attachments (Asahi Lina) - drm/asahi: initdata: Document more stuff (Asahi Lina) - drm/asahi: initdata: Fix 13.5 field position for G13X (Asahi Lina) - drm/asahi: fw/channels: Document more message types a bit (Asahi Lina) - drm/asahi: fw/channels: Identify subpipe(?) and halt_count fields in tvb ack (Asahi Lina) - drm/asahi: initdata: Fix ver_info for G13 V13.5 (Asahi Lina) - drm/asahi: hw: Drop max_dies (Asahi Lina) - drm/asahi: hw,initdata: Initdata fixes for G14S (Asahi Lina) - drm/asahi: render: Implement unknown value UAPI extension (Asahi Lina) - DO NOT MERGE: drm/asahi: Add an experimental UAPI extension (Asahi Lina) - drm/asahi: Add the Asahi driver for Apple AGX GPUs (Asahi Lina) - rust: bindings: Bind the Asahi DRM UAPI (Asahi Lina) - drm/asahi: Add the Asahi driver UAPI (Asahi Lina) - rust: macros: Add versions macro (Asahi Lina) - drm/gpuvm: Plumb through flags into drm_gpuva_init (Asahi Lina) - drm/gpuva: Add DRM_GPUVA_SINGLE_PAGE flag and logic (Asahi Lina) - drm/gpuvm: Plumb through flags into drm_gpuva_op_map (Asahi Lina) - drm/gpuvm: Add a flags argument to drm_gpuvm_sm_map[_*] (Asahi Lina) - rust: drm/gpuvm: Add GpuVaFlags support (Asahi Lina) - rust: drm/gpuvm: Add interruptible flag to exec_lock() (Asahi Lina) - rust: drm/gpuvm: bo_unmap() should take &GpuVmBo, not ARef. (Asahi Lina) - rust: drm/gpuvm: Pass vm_bo explicitly to step_remap() (Asahi Lina) - rust: drm/gpuvm: Take &GpuVmBo for map_and_link_va() (Asahi Lina) - rust: drm: Add GPUVM Manager abstraction (Asahi Lina) - drm/gpuvm: Add drm_gpuvm_bo_unmap() (Asahi Lina) - rust: drm: sched: Use &mut for ArmedJob.fences() (Janne Grunau) - drm/scheduler: Clean up jobs when the scheduler is torn down. (Asahi Lina) - rust: drm: sched: Add GPU scheduler abstraction (Asahi Lina) - drm/scheduler: Fix UAF in drm_sched_fence_get_timeline_name (Asahi Lina) - rust: drm: syncobj: Add DRM Sync Object abstraction (Asahi Lina) - rust: drm: mm: Add DRM MM Range Allocator abstraction (Asahi Lina) - rust: drm: gem: shmem: Add share_dma_resv() function (Asahi Lina) - rust: drm: gem: Add set_exportable() method (Asahi Lina) - drm/gem: Add a flag to control whether objects can be exported (Asahi Lina) - rust: drm: gem: shmem: Add DRM shmem helper abstraction (Asahi Lina) - rust: helpers: Add bindings/wrappers for dma_resv_lock (Asahi Lina) - drm/gem-shmem: Export VM ops functions (Asahi Lina) - drm/shmem-helper: Add lockdep asserts to vmap/vunmap (Asahi Lina) - rust: drm: gem: Add GEM object abstraction (Asahi Lina) - rust: drm: file: Add File abstraction (Asahi Lina) - rust: drm: add DRM driver registration (Danilo Krummrich) - rust: drm: add device abstraction (Danilo Krummrich) - rust: drm: add driver abstractions (Danilo Krummrich) - rust: drm: ioctl: Add DRM ioctl abstraction (Asahi Lina) - rust: dma_fence: Add DMA Fence abstraction (Asahi Lina) - drm: apple: Use piodma default iommu domain (Janne Grunau) - fixup! drm/apple: Get rid of the piodma dummy driver (Janne Grunau) - fixup! WIP: drm/apple: Add DCP display driver (Janne Grunau) - drm/apple: fix audioless build (Alyssa Rosenzweig) - drm: apple: dptx: Issue HPD event early on gpio/type-c disconnect (Janne Grunau) - drm: apple: dptx: Configure number of lanes for dptx-phy (Janne Grunau) - drm: apple: HDMI: Check HPD state before enabling the IRQ (Janne Grunau) - drm: apple: dptx: Rework/document get_max_lane_count() (Janne Grunau) - drm: apple: iomfb: Adapt `IOMFB_METHOD` for gcc 15 (Janne Grunau) - drm: apple: audio: Rework audio service handling (Janne Grunau) - drm: apple: afk: Allow replies after service 'teardown' (Janne Grunau) - drm: apple: dptx: Tidy up lane count handling (Janne Grunau) - drm: apple: dptx: Silence DPTX_APCALL_{GET,SET}_DOWN_SPREAD (Janne Grunau) - drm: apple: Handle dcps with "phys" property as dcpext (Janne Grunau) - drm: apple: Support up to 3 DCP instances. (Janne Grunau) - drm: apple: Revert "Use delayed work for debounced oob HPD" (Janne Grunau) - drm: apple: Use delayed work for debounced oob HPD (Janne Grunau) - drm: apple: iomfb: Clear non-visible planes (Janne Grunau) - drm: apple: Use dest rct in offscreen test (Janne Grunau) - drm: apple: refactor apple_plane_atomic_check (Janne Grunau) - drm: apple: make plane zpos immutable (James Calligeros) - drm: apple: warn about broken sw cursor fallback (James Calligeros) - drm: apple: use correct min/max plane scaling factors (James Calligeros) - drm: apple: add support for overlay planes (James Calligeros) - drm: apple: reject plane commit if it will crash DCP (James Calligeros) - drm: apple: constrain swaps to maximum blendable surfaces (James Calligeros) - drm: apple: respect drm_plane_state zpos (James Calligeros) - drm: apple: Add .get_scanout_buffer for drm_panic support (Janne Grunau) - drm: apple: Add CRTC CRC support (Janne Grunau) - drm: apple: audio: Implement runtime PM support (Janne Grunau) - drm: apple: Enable EDID support by default (Janne Grunau) - ALSA: Introduce 'snd_interval_rate_bits' (Martin Povišer) - drm: apple: iomfb: Provide the EDID as connector property (Janne Grunau) - drm: apple: Add dcpav-service-ep (Janne Grunau) - drm: apple: afk: Optionally match against EPICName (Janne Grunau) - Revert "drm: apple: HACK: Do not delete piodma platform device" (Janne Grunau) - drm: apple: iomfb: Align buffer size on unmap/free as well (Janne Grunau) - drm/apple: Fix missing mode init (feel free to squash) (Asahi Lina) - drm: apple: dptxport: get_max_lane_count: Retrieve lane count from phy (Janne Grunau) - drm: apple: dptx: Fix get_drive_settings retcode (Janne Grunau) - drm: apple: Add oob hotplug event (Sven Peter) - drm/apple: audio: Fix hotplug notifications (Asahi Lina) - drm/apple: audio: Defer DMA channel acquisition to device open (Asahi Lina) - drm/apple: audio: Create a device link to the DMA device (Asahi Lina) - drm/apple: Explicitly stop AFK endpoints on shutdown (Asahi Lina) - drm: apple: Override drm_vblank's page flip event handling [HACK] (Janne Grunau) - drm: apple: disable HDMI audio by default (Janne Grunau) - drm: apple: av: Warn only once about failed calls (Janne Grunau) - drm: apple: Reduce log spam about busy command channel (Janne Grunau) - drm: apple: Fix broken MemDescRelay::release_descriptor callback number (Janne Grunau) - drm: apple: Switch back to drm_atomic_helper_commit_tail_rpm() (Janne Grunau) - drm: apple: backlight: release lock in error path (Caspar Schutijser) - drm/apple: fix double words in comments (Jonathan Gray) - drm: apple: audio: Avoid probe errors (Janne Grunau) - drm: apple: audio: Make the DP/HDMI audio driver a full driver (Janne Grunau) - drm: apple: audio: move the audio driver into the DCP module (Janne Grunau) - drm: apple: av: Use a workqueue (Janne Grunau) - drm: apple: audio: init AV endpoint later (Janne Grunau) - drm: apple: dptx: Remove DPTX disconnect/connect on init (Janne Grunau) - gpu: drm: apple: Add DCP audio driver (Martin Povišer) - drm: apple: av: Do not open AV service from afk receive handler (Janne Grunau) - drm: apple: av: Support macOS 12.3 and 13.5 firmware APIs (Janne Grunau) - gpu: drm: apple: Set up client of AV endpoint (Martin Povišer) - gpu: drm: apple: Expose injecting of EPIC calls via debugfs (Martin Povišer) - drm: apple: iomfb: export property dicts in connector debugfs (Janne Grunau) - drm: apple: Add Kconfig option for audio (Janne Grunau) - drm: apple: dptx: Debounce HPD by simple msleep() (Janne Grunau) - drm: apple: Fix/remove log messages (Janne Grunau) - drm: apple: backlight: force backlight update after resume (Mark Kettenis) - drm/apple: spelling fixes (Jonathan Gray) - drm/apple: Add missing RTKit Kconfig dependency (Alyssa Ross) - drm: apple: mark local functions static (Arnd Bergmann) - drm: apple: epic: systemep: Parse "mNits" log events (Janne Grunau) - drm: apple: epic: Pass full notfiy/report payload to handler (Janne Grunau) - drm: apple: parser: constify parser data (Janne Grunau) - drm: apple: iomfb: Always parse DisplayAttributes (Janne Grunau) - drm: apple: Prefer RGB SDR modes (Janne Grunau) - drm: apple: dptx: Wait for link config on connect (Janne Grunau) - drm: apple: Be less noisy about teardown notifies without service (Janne Grunau) - drm: apple: dcp: Fix resume with DPTX based display outputs (Janne Grunau) - drm: apple: Adjust startup sequence and timing for dptx (Janne Grunau) - drm: apple: iomfb: Extend hotplug/mode parsing logging (Janne Grunau) - drm : apple: iomfb: Handle OOB ASYNC/CB context (Janne Grunau) - drm: apple: iomfb: Use drm_kms_helper_connector_hotplug_event (Janne Grunau) - drm: apple: Fix DPTX hotplug handling (Janne Grunau) - drm: apple: Move modeset into drm_crtc's atomic_enable (Janne Grunau) - drm: apple: dptx: Log connect/disconnect calls (Janne Grunau) - drm: apple: Extract modeset crtc's atomic_flush() (Janne Grunau) - drm: apple: iomfb: Improve hotplug related logging (Janne Grunau) - drm: apple: HPD: Only act on connect IRQs (Janne Grunau) - drm: apple: dptx: Wait for completion of dptx_connect. (Janne Grunau) - drm: apple: Disconnect dptx When the CRTC is powered down (Janne Grunau) - drm: apple: dptx: Implement APCALL_DEACTIVATE and reset the phy (Janne Grunau) - Revert "drm: apple: iomfb: Do not match/create PMU service for dcpext" (Janne Grunau) - drm: apple: Keep information at which swap_id fb are still referenced (Janne Grunau) - drm: apple: Implement D592 callback (Janne Grunau) - drm: apple: afk: Update read pointer before processing message (Janne Grunau) - drm: apple: HACK: Do not delete piodma platform device (Janne Grunau) - drm: apple: dptxep: Implement drive settings stuff (Hector Martin) - drm: apple: dptxep: Fix reply size check (Hector Martin) - drm: apple: Fix missing unlock path in dcp_dptx_connect (Hector Martin) - drm: apple: afk: Clear commands before sending them (Hector Martin) - drm: apple: dptx: Adapt dptxport_connect() to observed behavior (Janne Grunau) - drm: apple: dptx: Add DPTX_APCALL_ACTIVATE (Janne Grunau) - drm: apple: dptx: Add set_active_lanes APCALL (Janne Grunau) - drm: apple: dptx: port interface to macOS 13.5 firmware (Janne Grunau) - drm: apple: dptx: Port APCALL to macOS 13.3 firmware (Janne Grunau) - drm: apple: afk: Adapt to macOS 13.3 firmware (Janne Grunau) - drm: apple: iomfb: Do not match/create PMU service for dcpext (Janne Grunau) - drm: apple: Move offsets for rt_bandwidth callback to DT (Janne Grunau) - drm: apple: Add DPTX support (Sven Peter) - drm: apple: afk: Use linear array of services (Janne Grunau) - drm: apple: DCP AFK/EPIC support (Sven Peter) - gpu: drm: apple: Add sound mode parsing (Martin Povišer) - gpu: drm: apple: Add 'parse_blob' (Martin Povišer) - gpu: drm: apple: Add utility functions for matching on dict keys (Martin Povišer) - mux: apple dp crossbar: Support t602x DP cross bar variant (Janne Grunau) - mux: apple dp crossbar: Read UNK_TUNABLE before and after writing it (Janne Grunau) - mux: apple dp crossbar: FIFO_RD_UNK_EN seems to use 2 bits per dispext* (Janne Grunau) - mux: apple dp crossbar: Support t8112 varient (Janne Grunau) - mux: apple DP xbar: Add Apple silicon DisplayPort crossbar (Sven Peter) - drm: apple: Remove explicit asc-dram-mask handling (Janne Grunau) - drm: apple: iomfb: Increase modeset tiemout to 8.5 seconds (Janne Grunau) - drm: apple: iomfb: implement abort_swaps_dcp (Janne Grunau) - drm: apple: dcp: Remove cargo-culted devm_of_platform_populate (Janne Grunau) - drm: apple: dcp: Port over to DEFINE_SIMPLE_DEV_PM_OPS (Janne Grunau) - drm: apple: Update supported firmware versions to 12.3 and 13.5 (Janne Grunau) - drm: apple: Add D129 allocate_bandwidth iomfb callback (Janne Grunau) - drm: apple: Align PIODMA buffers to SZ_16K (Janne Grunau) - drm/apple: Use iommu domain for piodma maps (Janne Grunau) - drm/apple: Get rid of the piodma dummy driver (Janne Grunau) - drm: apple: backlight: avoid updating the brightness with a commit (Janne Grunau) - drm: apple: iomfb: limit backlight updates to integrated panels (Janne Grunau) - drm: apple: Only match backlight service on DCP with panel (Janne Grunau) - drm: apple: iomfb: Increase modeset timeout to 2.5 seconds (Janne Grunau) - drm/apple: Mark DCP as being in the wakeup path (Hector Martin) - drm/apple: Remove simpledrm framebuffer before DRM device alloc (Janne Grunau) - WIP: drm/apple: Port to incompatible V13.3 firmware interface (Janne Grunau) - dcp: Warn if DMA mapping fails (Hector Martin) - dcp: T602X bwreq support (Hector Martin) - dcp: 42-bit DMA masks (Hector Martin) - dcp: Add get_tiling_state (Hector Martin) - dcp: Allow unused trampolines (Hector Martin) - drm/apple: Drop unsupported DRM_FORMAT_ARGB2101010 (Janne Grunau) - drm/apple: Support color transformation matrices (Janne Grunau) - drm/apple: ignore surf[3] in clear swap calls (Janne Grunau) - drm/apple: Add support for the macOS 13.2 DCP firmware (Janne Grunau) - drm/apple: Add callbacks triggered by last_client_close_dcp() (Janne Grunau) - drm/apple: purge unused dcp_update_notify_clients_dcp (Janne Grunau) - drm/apple: Align buffers to 16K page size (Asahi Lina) - drm/apple: Move panel options to its own sub-struct (Janne Grunau) - drm/apple: Use backlight_get_brightness() (Janne Grunau) - drm/apple: Set backlight level indirectly if no mode is set (Janne Grunau) - drm/apple: Fix bad error return (Asahi Lina) - drm/apple: Fix parse_string() memory leaks (Asahi Lina) - drm/apple: simplify IOMFB_THUNK_INOUT (Janne Grunau) - gpu: drm: apple: Wait for iomfb initialization (Janne Grunau) - gpu: drm: apple: Use components to avoid deferred probing (Janne Grunau) - drm/apple: Allocate drm objects according to drm's expectations (Janne Grunau) - drm/apple: Use drm_module_platform_driver (Janne Grunau) - gpu: drm: apple: Use aperture_remove_conflicting_devices (Janne Grunau) - drm/apple: Update swap handling (Janne Grunau) - gpu: drm: apple: Clear all surfaces on startup (Janne Grunau) - drm/apple: Enable 10-bit mode & set colorspace to native (Hector Martin) - Revert "gpu: drm: apple: reenable support for {A,X}RGB2101010" (Janne Grunau) - gpu: drm: apple: Add show_notch module parameter (Janne Grunau) - gpu: drm: apple: reenable support for {A,X}RGB2101010 (Janne Grunau) - gpu: drm: apple: Add IOMobileFramebufferAP::get_color_remap_mode (Janne Grunau) - gpu: drm: apple: Prefer SDR color modes (Janne Grunau) - gpu: drm: apple: Add tracing for color and timing modes (Janne Grunau) - gpu: drm: apple: Skip parsing elements of virtual timing modes (Janne Grunau) - gpu: drm: apple: Parse color modes completely (Janne Grunau) - drm/apple: Disable fake vblank IRQ machinery (Asahi Lina) - drm/apple: Check if DCP firmware is supported (Janne Grunau) - drm/apple: Report "PMUS.Temperature" only for mini-LED backlights (Janne Grunau) - drm/apple: Schedule backlight update on enable_backlight_message_ap_gated (Janne Grunau) - drm/asahi: Fix backlight restores on non-microLED devices (Asahi Lina) - drm/apple: Remove obsolete ignore_swap_complete (Asahi Lina) - drm/apple: Wait for power on request to complete synchronously (Asahi Lina) - drm/apple: Read display dimensions from devicetree (Janne Grunau) - drm/apple: Implement drm_crtc_helper_funcs.mode_fixup (Janne Grunau) - drm/apple: Add trace point for display brightness (Janne Grunau) - drm/apple: register backlight device after IOMFB start (Janne Grunau) - gpu: drm: apple: Avoid drm_fb_dma_get_gem_addr (Janne Grunau) - drm/apple: Fix suspend/resume handling (Hector Martin) - HACK: gpu: drm: apple: j314/j316: Ignore 120 Hz mode for integrated display (Janne Grunau) - gpu: drm: apple: Brightness control via atomic commits (Janne Grunau) - gpu: drm: apple: "match" PMU/backlight services on init (Janne Grunau) - gpu: drm: apple: iomfb: Unify call and callback channels (Janne Grunau) - gpu: drm: apple: iomfb: Use FIELD_{GET,PREP} (Janne Grunau) - gpu: drm: apple: Prevent NULL pointer in dcp_hotplug (Janne Grunau) - gpu: drm: apple: Set maximal framebuffer size correctly (Janne Grunau) - gpu: drm: apple: Fix shutdown of partially probed dcp (Janne Grunau) - gpu: drm: apple: Provide notch-less modes (Janne Grunau) - gpu: drm: apple: Support opaque pixel formats (Janne Grunau) - gpu: drm: apple: Remove other framebuffers before DRM setup (Janne Grunau) - gpu: drm: apple: Specify correct number of DCP*s for drm_vblank_init (Janne Grunau) - gpu: drm: apple: Fix DCP initialisation (Janne Grunau) - gpu: drm: apple: Fix DCP run time PM (Janne Grunau) - gpu: drm: apple: Add dcp_crtc_atomic_check (Janne Grunau) - gpu: drm: apple: Send an disconnected hotplug event on ASC crash (Janne Grunau) - gpu: drm: apple: Convert 2 non-assert WARN()s to dev_err() (Janne Grunau) - gpu: drm: apple: Reject modes without valid color mode (Janne Grunau) - gpu: drm: apple: Add apple_drm_gem_dumb_create() (Janne Grunau) - gpu: drm: apple: Add support for DRM_FORMAT_XRGB2101010 (Janne Grunau) - gpu: drm: apple: Unbreak multiple DCP plane <-> crtc matching (Janne Grunau) - gpu: drm: apple: Start using tracepoints (Janne Grunau) - drm: apple: Replace atomic refcount with kref (Janne Grunau) - drm: apple: Fix connector state on devices with integrated display (Janne Grunau) - gpu: drm: apple: Use connector types from devicetree (Janne Grunau) - WIP: add header test target copied from i915 (Janne Grunau) - drm/apple: Split dcpep/iomfb out of dcp.c (Janne Grunau) - drm/apple: make note about drm.mode_config.max_width/height (Janne Grunau) - drm/apple: Mark the connecter on init only with modes as connected (Janne Grunau) - drm/apple: Allow modesets even when disconnected (Janne Grunau) - drm/apple: Fix kzalloc in dcp_flush() (Asahi Lina) - drm/apple: laod piodma dev via explicit phandle (Janne Grunau) - WIP: drm/apple: Change the way to clear unused surfaces (Janne Grunau) - drm/apple: Support memory unmapping/freeing (Janne Grunau) - drm/apple: clear callback's output data (Janne Grunau) - drm/apple: implement read_edt_data (Janne Grunau) - drm/apple: Add less tons of questionable debug prints (Janne Grunau) - drm/apple: Add somewhat useful debug prints (Janne Grunau) - drm/apple: toggle power only when active state changes (Janne Grunau) - drm/apple: Add t600x support (Janne Grunau) - drm/apple: Clear used callback/cookie on dcp_ack (Janne Grunau) - drm/apple: Add DCP interface definitions used on t600x (Janne Grunau) - drm/apple: Log callbacks with their tag as debug output (Janne Grunau) - drm/apple: Switch to nonblocking commit handling (Janne Grunau) - drm/apple: dcp: fix TRAMPOLINE_IN macro (Janne Grunau) - drm/apple: Implement suspend/resume for DCP (Alyssa Rosenzweig) - drm/apple: Use "apple,asc-dram-mask" for rtkit iovas (Janne Grunau) - drm/apple: Reference only swapped out framebuffers (Janne Grunau) - drm/apple: Add nop sr_set_uint_prop callback for t600x-dcp (Janne Grunau) - drm/apple: Fix rt_bandwidth for t600x (Janne Grunau) - drm/apple: Use a device tree defined clock for dcpep_cb_get_frequency (Janne Grunau) - HACK: drm/apple: avoid DCP swaps without attached surfaces (Janne Grunau) - drm/apple: Start coprocessor on probe (Janne Grunau) - drm: apple: Relicense DCP driver as dual MIT / GPL v2.0 (Janne Grunau) - WIP: drm/apple: Add DCP display driver (Alyssa Rosenzweig) - rust: helpers: Add dma_mapping_error() helper (Sasha Finkelstein) - rust: io: Add helper for memcpy_toio (Sasha Finkelstein) - Rust: io: Add memcpy_fromio wrapper (Asahi Lina) - rust: kernel: {arc, kbox}: use pin_coerce_unsized_trait (Janne Grunau) - rust: add unstable feature associated_type_defaults (Janne Grunau) - rust: Enable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: kernel: workqueue: Disable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: print: Disable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: init: macros: Disable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: init: Disable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: init: Add default() utility function (Asahi Lina) - rust: bindgen: Exclude list functions with unsupported ABIs (Asahi Lina) - rust: of: Add wrapper for of_property_present() (Janne Grunau) - rust: of: Add Node::address_as_resource() (Asahi Lina) - rust: page: Add physical address conversion functions (Asahi Lina) - rust: addr: Add a module to declare core address types (Asahi Lina) - rust: page: Make with_page_mapped() and with_pointer_into_page() public (Asahi Lina) - rust: page: Convert to Ownable (Asahi Lina) - rust: Add Ownable/Owned types (Asahi Lina) - HACK: rust: of: add as_raw() (Janne Grunau) - rust: of: Add parse_phandle_by_name() (Janne Grunau) - rust: Fix x86 build (Hector Martin) - rust: of: Add OF node abstraction (Asahi Lina) - rust: device: Add Device::parent() (Sasha Finkelstein) - rust: soc: apple: rtkit: Add Apple RTKit abstraction (Asahi Lina) - rust: xarray: Add an abstraction for XArray (Asahi Lina) - *RFL import: kernel::delay (Asahi Lina) - rust: Add time_namespace helpers (Asahi Lina) - rust: time: New module for timekeeping functions (Asahi Lina) - rust: sync: arc: Add lockdep integration (Asahi Lina) - rust: sync: Add LockdepMap abstraction (Asahi Lina) - rust: init: Update documentation for new mutex init style (Asahi Lina) - rust: sync: Classless Lock::new() and pin_init() (Asahi Lina) - rust: sync: Implement dynamic lockdep class creation (Asahi Lina) - rust: sync: Replace static LockClassKey refs with a pointer wrapper (Asahi Lina) - rust: sync: Add dummy LockClassKey implementation for !CONFIG_LOCKDEP (Asahi Lina) - Revert "rust: lockdep: Remove support for dynamically allocated LockClassKeys" (Janne Grunau) - rust: kernel: Add simple siphash abstraction (Asahi Lina) - rust: Use absolute paths to build Rust objects (Asahi Lina) - rust: types: Add Opaque::zeroed() (Asahi Lina) - rust: init: Support type paths in pin_init!() and friends (Asahi Lina) - rust: init: Implement Zeroable::zeroed() (Asahi Lina) - rust: kernel: lock: Add Lock::pin_init() (Asahi Lina) - rust: str: allow dereferencing BStr in a const ctx (Fabien Parent) - rust: alloc: Flags: Switch to declare_flags_type!() macro. (Asahi Lina) - rust: types: Add declare_flags_type() (Asahi Lina) - rust: alloc: Add .resize() to Vec (Sasha Finkelstein) - rust: alloc: vec: Import .drain() / Drain from rust library (Janne Grunau) - rust: alloc: vec: Add TryFrom trait (Janne Grunau) - rust: alloc: Vec: Implement .clear()/.truncate() (Janne Grunau) - rust: alloc: kbox: Add CoerceUnsized trait (Janne Grunau) - rust: alloc: kbox: Add AsRef implementation to Box (Sasha Finkelstein) - rust: allocator: Disable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: Add a Sealed trait (Asahi Lina) - rust: error: Add ENOSYS from uapi/asm-generic/errno.h (Janne Grunau) - rust: error: Add ECANCELED from uapi/asm-generic/errno.h (Janne Grunau) - rust: error: Add ENODATA from uapi/asm-generic/errno.h (Janne Grunau) - rust: error: Add ETIMEDOUT from uapi/asm-generic/errno.h (Janne Grunau) - rust: dma: add as_slice/write functions for CoherentAllocation (Abdiel Janulgue) - rust: platform: implement the `dma::Device` trait (Danilo Krummrich) - rust: pci: implement the `dma::Device` trait (Danilo Krummrich) - rust: dma: add dma addressing capabilities (Danilo Krummrich) - rust: dma: implement `dma::Device` trait (Danilo Krummrich) - modules: add rust modules files to MAINTAINERS (Andreas Hindborg) - rust: add parameter support to the `module!` macro (Andreas Hindborg) - rust: str: add radix prefixed integer parsing functions (Andreas Hindborg) - rust: io: mem: Add Mem abstraction (Asahi Lina) - rust: io: mem: Support non-posted write semantics (Janne Grunau) - rust: io: resource: Add resource flag IORESOURCE_MEM_NONPOSTED (Janne Grunau) - rust: io: add resource abstraction (ffi fixes) (Janne Grunau) - rust: platform: allow ioremap of platform resources (Daniel Almeida) - rust: io: mem: add a generic iomem abstraction (Daniel Almeida) - rust: io: add resource abstraction (Daniel Almeida) - rust: str: implement `strip_prefix` for `BStr` (Andreas Hindborg) - rust: str: implement `AsRef` for `[u8]` and `BStr` (Andreas Hindborg) - rust: str: implement `Index` for `BStr` (Andreas Hindborg) - rust: str: implement `PartialEq` for `BStr` (Andreas Hindborg) - MAINTAINERS: add entry for Rust dma mapping helpers device driver API (Abdiel Janulgue) - rust: add dma coherent allocator abstraction (Abdiel Janulgue) - rust: error: Add EOVERFLOW (Abdiel Janulgue) - rust: module: introduce `authors` key (Guilherme Giacomo Simoes) - panic_qr: use new #[export] macro (Alice Ryhl) - print: use new #[export] macro for rust_fmt_argument (Alice Ryhl) - rust: add #[export] macro (Alice Ryhl) - rust: macros: support additional tokens in quote! (Alice Ryhl) - dmaengine: apple-sio: Implement runtime PM (Janne Grunau) - dmaengine: apple-sio: Fix chan freeing in error path (Asahi Lina) - dmaengine: apple-sio: Add Apple SIO driver (Martin Povišer) - dt-bindings: dma: apple,sio: Add schema (Martin Povišer) - phy: apple: atc: Ensure DP mode is used for DP-only ATC phys (Janne Grunau) - phy: apple: atc: Add missing mutex_unlock in error case (Janne Grunau) - phy: apple: dptx: Add debug prints for unexpected values (Janne Grunau) - phy: apple: atc: support mode switches in atcphy_dpphy_set_mode() (Janne Grunau) - HACK: phy: apple: atc: Ignore fake submodes (Janne Grunau) - phy: apple: atc: Support 'set_lanes' in DP mode (Janne Grunau) - phy: apple: atc: Support DisplayPort only operation (Janne Grunau) - phy: apple: atc: Reorder ACIOPHY_CROSSBAR and ACIOPHY_MISC ops (Janne Grunau) - phy: apple: atc: Split atcphy_dp_configure_lane() (Janne Grunau) - phy: apple: Add DP TX phy driver (Janne Grunau) - usb: typec: tipd: Clear interrupts first (Sven Peter) - WIP: phy: apple: Add Apple Type-C PHY (Sven Peter) - nvmem: round up to word_size (Sven Peter) - nvmem: allow bit offset > 8 (Sven Peter) - Revert "nvmem: core: Print error on wrong bits DT property" (Janne Grunau) - xhci-pci: asmedia: Add a firmware loader for ASM2214a chips (Hector Martin) - PCI: apple: Avoid PERST# deassertion through gpiod initialization (Janne Grunau) - PCI: apple: Log the time it takes for links to come up (Hector Martin) - PCI: apple: Reorder & improve link-up logic (Hector Martin) - PCI: apple: Make link up timeout configurable, default to 500ms (Hector Martin) - PCI: apple: Skip controller port setup for online links (Janne Grunau) - PCI: apple: Add support for optional PWREN GPIO (Hector Martin) - PCI: apple: Probe all GPIOs for availability first (Hector Martin) - dt-bindings: pci: apple,pcie: Add subnode binding, pwren-gpios property (Hector Martin) - PCI: apple: Add T602x PCIe support (Hector Martin) - PCI: apple: Abstract register offsets via a SoC-specific structure (Hector Martin) - PCI: apple: Use gpiod_set_value_cansleep in probe flow (Hector Martin) - PCI: apple: Drop poll for CORE_RC_PHYIF_STAT_REFCLK (Hector Martin) - PCI: apple: Move port PHY registers to their own reg items (Hector Martin) - PCI: apple: Set only available ports up (Janne Grunau) - PCI: apple: Fix missing OF node reference in apple_pcie_setup_port (Hector Martin) - PCI: apple: Move away from INTMSK{SET,CLR} for INTx and private interrupts (Marc Zyngier) - PCI: apple: Dynamically allocate RID-to_SID bitmap (Marc Zyngier) - PCI: apple: Move over to standalone probing (Marc Zyngier) - PCI: ecam: Allow cfg->priv to be pre-populated from the root port device (Marc Zyngier) - PCI: host-generic: Extract an ecam bridge creation helper from pci_host_common_probe() (Marc Zyngier) - dt-bindings: pci: apple,pcie: Add t6020 compatible string (Alyssa Rosenzweig) - nvmem: spmi-mfd-nvmem: use legacy fixed layout (Janne Grunau) - nvmem: Add spmi-mfd-nvmem driver (Hector Martin) - mfd: Add a simple-mfd-spmi driver (Hector Martin) - spmi: add a first basic spmi driver for Apple SoC (Jean-Francois Bortolotti) - hwmon: macsmc: wire up manual fan control support (James Calligeros) - platform/apple: smc: Add apple_smc_write_f32_scaled (Janne Grunau) - power: supply: macsmc_power: Report not charging for CHLS thresholds (Janne Grunau) - power: supply: macsmc_power: Remove CSIL (Hector Martin) - power: supply: macsmc_power: Add CHLS charge thresholds (Hector Martin) - hwmon: macsmc: Avoid global writable hwmon_chip_info (Janne Grunau) - hwmon: add macsmc-hwmon driver (James Calligeros) - platform/apple: smc: Add apple_smc_read_ioft_scaled (Janne Grunau) - power: supply: macsmc_power: Add more properties (Hector Martin) - power: supply: macsmc_power: Report available charge_behaviours (Thomas Weißschuh) - power: supply: macsmc_power: Add CHWA charge thresholds (Hector Martin) - power: supply: macsmc_power: Log power data on button presses (Hector Martin) - macsmc: Fix race between backend and core on notifications (Hector Martin) - power: supply: macsmc_power: Add a debug mode to print power usage (Hector Martin) - platform/apple: smc: Add apple_smc_read_f32_scaled (Hector Martin) - power: supply: macsmc_power: Add critical level shutdown & misc events (Hector Martin) - Input: macsmc-hid: Support the power button on desktops (Hector Martin) - gpio: macsmc: Add IRQ support (Hector Martin) - Input: macsmc-hid: Support button/lid wakeups (Hector Martin) - Input: macsmc-hid: New driver to handle the Apple Mac SMC buttons/lid (Hector Martin) - rtc: Add new rtc-macsmc driver for Apple Silicon Macs (Hector Martin) - power: reset: macsmc-reboot: Add driver for rebooting via Apple SMC (Hector Martin) - power: supply: macsmc_power: Add AC power supply (Hector Martin) - power: supply: macsmc_power: Turn off OBC flags if macOS left them on (Hector Martin) - power: supply: macsmc_power: Use BUIC instead of BRSC for charge (Hector Martin) - power: supply: macsmc_power: Add more props, rework others (Hector Martin) - power: supply: macsmc_power: Add present prop (Hector Martin) - power: supply: macsmc_power: Add cycle count and health props (Hector Martin) - power: supply: macsmc_power: Driver for Apple SMC power/battery stats (Hector Martin) - gpio: Add new gpio-macsmc driver for Apple Macs (Hector Martin) - platform/apple: Add new Apple Mac SMC driver (Hector Martin) - lib/vsprintf: Add support for generic FOURCCs by extending %p4cc (Hector Martin) - DO NOT MERGE: HID: apple: Add fnmode which ignores function keys (Janne Grunau) - HID: transport: spi: apple: Use distinctive names input devices (Janne Grunau) - HID: transport: spi: apple: Increase receive buffer size (Janne Grunau) - HID: magicmouse: Query device dimensions via HID report (Hector Martin) - HID: transport: spi: Implement GET FEATURE (Hector Martin) - HID: magicmouse: Handle touch controller resets on SPI devices (Hector Martin) - HID: Bump maximum report size to 16384 (Hector Martin) - HID: transport: spi: Add suspend support (Janne Grunau) - HID: magicmouse: Add .reset_resume for SPI trackpads (Janne Grunau) - HID: transport: spi: Check status message after transmits (Janne Grunau) - soc: apple: Add RTKit helper driver (Hector Martin) - hid: Add Apple DockChannel HID transport driver (Hector Martin) - soc: apple: Add DockChannel driver (Hector Martin) - hid: magicmouse: Add MTP multi-touch device support (Hector Martin) - hid: apple: Bind to HOST devices for MTP (Hector Martin) - HID: core: Handle HOST bus type when announcing devices (Hector Martin) - HID: add HOST vendor/device IDs for Apple MTP devices (Hector Martin) - WIP: HID: transport: spi: add Apple SPI transport (Janne Grunau) - HID: magicmouse: add support for Macbook trackpads (Janne Grunau) - HID: magicmouse: use ops function pointers for input functionality (Janne Grunau) - HID: magicmouse: use struct input_mt_pos for X/Y (Janne Grunau) - HID: magicmouse: use a define of the max number of touch contacts (Janne Grunau) - HID: apple: add Fn key mapping for Macbook Pro with touchbar (Janne Grunau) - HID: apple: add Fn key mapping for Apple silicon MacBooks (Janne Grunau) - HID: apple: add support for internal keyboards (Janne Grunau) - HID: add device IDs for Apple SPI HID devices (Janne Grunau) - fixup! wifi: brcmfmac: Add support for firmware signatures (Janne Grunau) - [brcmfmac] Disable partial SAE offload (Daniel Berlin) - [brcmfmac] Clean up and common interface creation handling (Daniel Berlin) - [brcmfmac] Support bandwidth caps for all bands (Daniel Berlin) - [brcmfmac] Add support for more rate info in station dumps (Daniel Berlin) - [brcmfmac] Set chanspec during join. (Daniel Berlin) - [brcmfmac] Add support for more auth suites in roaming offload (Daniel Berlin) - [brcmfmac] Let feature attachment fail, and fail if we can't handle the interface versions we find. (Daniel Berlin) - [brcmfmac] Support new join parameter structure versions (Hector Martin) - [brcmfmac] Structurize scan parameter handling (Daniel Berlin) - [brcmfmac] Structurize PNF scan and add support for latest version (Daniel Berlin) - fixup! define missing event message extension (Daniel Berlin) - fixup! fix FWIL definition to use SSID length constant (Daniel Berlin) - [brcmfmac] Fix regulatory domain handling to reset bands properly (Daniel Berlin) - [brcmfmac] Add support for 6G bands and HE (Daniel Berlin) - [brcmfmac] Support high power/low power/etc scan flags (Daniel Berlin) - [brcmfmac] Support GCMP cipher suite, used by WPA3. (Daniel Berlin) - [brcmfmac] Compute number of available antennas and set it in wiphy structure. (Daniel Berlin) - [brcmfmac] Dynamically configure VHT settings to match firmware (Daniel Berlin) - [brcmfmac] Add support for encoding/decoding 6g chanspecs (Daniel Berlin) - [brcmfmac] Finish firmware mem map, fix heap start calculation bug. (Daniel Berlin) - brcmfmac: Fix AP mode (Patrick Blass) - wifi: brcmfmac: Add BCM4388 support (Hector Martin) - wifi: brcmfmac: Extend brcmf_wsec_pmk_le (Hector Martin) - wifi: brcmfmac: Support bss_info up to v112 (Hector Martin) - wifi: brcmfmac: Implement event_msgs_ext (Hector Martin) - wifi: brcmfmac: Add support for SCAN_V3 (Hector Martin) - wifi: brcmfmac: Mask all IRQs before starting firmware (Hector Martin) - wifi: brcmfmac: Do not set reset vector when signatures are in use (Hector Martin) - wifi: brcmfmac: pcie: Initialize IRQs before firmware boot (Hector Martin) - wifi: brcmfmac: pcie: Access pcie core registers via dedicated window (Hector Martin) - wifi: brcmfmac: Handle watchdog properly in newer cores (Hector Martin) - wifi: brcmfmac: chip: ca7: Only disable D11 cores; handle an arbitrary number (Hector Martin) - wifi: brcmfmac: Increase bandlist size (Hector Martin) - wifi: brcmfmac: msgbuf: Increase RX ring sizes to 2048 (Hector Martin) - wifi: brcmfmac: Add support for firmware signatures (Hector Martin) - wifi: brcmfmac: Add support for SYSMEM corerev >= 12 & fix < 12 (Hector Martin) - wifi: brcmfmac: Do not service msgbuf IRQs until ready in MSI mode (Hector Martin) - wifi: brcmfmac: Shut up p2p unknown frame error (Hector Martin) - wifi: brcmfmac: Support exchanging power mailbox messages via commonring (Hector Martin) - wifi: brcmfmac: Implement the H2D/D2H mailbox data commonring messages (Hector Martin) - wifi: brcmfmac: Add a new bus op for D2H mailbox message handling (Hector Martin) - wifi: brcmfmac: Add newer msgbuf packet types up to 0x2e (Hector Martin) - wifi: brcmfmac: Support v6+ flags and set host_cap properly (Hector Martin) - wifi: brcmfmac: Fix logic for deciding which doorbell registers to use (Hector Martin) - wifi: brcmfmac: Handle PCIe MSI properly (Hector Martin) - wifi: brcmfmac: Add missing shared area defines to pcie.c (Hector Martin) - fixup! ASoC: macaudio: Sense improvements (Janne Grunau) - fixup! ASoC: macaudio: Sense improvements (Janne Grunau) - fixup! ASoC: macaudio: Sense improvements (Janne Grunau) - fixup! ASoC: apple: Add macaudio machine driver (Janne Grunau) - soc: apple: rtkit: Add tracekit endpoint. (Sasha Finkelstein) - soc: apple: rtkit: Add apple_rtkit_has_endpoint() (Sasha Finkelstein) - DO NOT MERGE: dmaengine: apple-admac: Add temporary aop-admac compatible (Sasha Finkelstein) - READ COMMIT MESSAGE! macaudio: Enable second round of models (Hector Martin) - READ COMMIT MESSAGE! macaudio: Enable first round of models (Hector Martin) - ALSA: Support nonatomic dmaengine PCMs (Martin Povišer) - HACK: ALSA: Export 'snd_pcm_known_rates' (Martin Povišer) - fixup! dmaengine: apple-admac: Add Apple ADMAC driver (Martin Povišer) - macaudio: Fix missing kconfig requirement (Sasha Finkelstein) - ASoC: apple: mca: More delay (Hector Martin) - ASoC: apple: mca: Add more delay after configuring clock (Hector Martin) - macaudio: Disable j313 and j274 (Hector Martin) - ASoC: apple: mca: Add delay after configuring clock (Hector Martin) - macaudio: Avoid matches against cs42l84's constrols (Janne Grunau) - macaudio: Fix CHECK return condition checking (Hector Martin) - macaudio: Sync all gains with macOS (Hector Martin) - macaudio: Turn please_blow_up_my_speakers into an int (Hector Martin) - macaudio: Change device ID form Jxxx to AppleJxxx (Hector Martin) - macaudio: Set the card name explicitly (Hector Martin) - ASoC: tas2770: Set the SDOUT polarity correctly (Hector Martin) - macaudio: Officially enable j313 speakers (Hector Martin) - macaudio: Skip speaker sense PCM if no sense or no speakers (Hector Martin) - macaudio: Remove -3dB safety pad from j313 (Hector Martin) - ASoC: tas2770: Support setting the PDM TX slot (Hector Martin) - ASoC: tas2770: Add zero-fill and pull-down controls (Hector Martin) - ASoC: tas2770: Power cycle amp on ISENSE/VSENSE change (Hector Martin) - ASoC: tas2770: Add SDZ regulator (Hector Martin) - macaudio: Rework platform config & add all remaining platforms (Hector Martin) - ASoC: tas2764: Enable some Apple quirks by default (Hector Martin) - ASoC: tas2764: Wait for ramp-down after shutdown (Hector Martin) - ALSA: dmaengine: Always terminate DMA when a PCM is closed (Hector Martin) - ASoC: apple: mca: Increase reset timeout (Hector Martin) - ASoC: tas2764: Mark SW_RESET as volatile (Hector Martin) - ASoC: tas2764: Add reg defaults for TAS2764_INT_CLK_CFG (Hector Martin) - macaudio: Use an explicit mutex for the speaker volume lock (Hector Martin) - ASoC: tas2764: Add SDZ regulator (Hector Martin) - ASoC: tas2764: Power up/down amp on mute ops (Hector Martin) - ASoC: tas2764: Enable main IRQs (Hector Martin) - macaudio: Disable debug (Hector Martin) - macaudio: Use the same volume limit for all amps (Hector Martin) - macaudio: Initialize speaker lock properly (Hector Martin) - macaudio: Enable VSENSE switches (Hector Martin) - macaudio: Allow DT enabled speakers and gate them off in the driver (Hector Martin) - ASoC: apple: mca: Do not mark clocks in use for non-providers (Hector Martin) - macaudio: Add a getter for the interlock (Hector Martin) - alsa: pcm: Remove the qos request only if active (Hector Martin) - macaudio: speaker volume safety interlocks (Hector Martin) - ASoC: ops: Export snd_soc_control_matches() (Hector Martin) - ASoC: macaudio: Sense improvements (Hector Martin) - ASoC: macaudio: Fix PD link double-frees? (Hector Martin) - ASoC: macaudio: Do not disable ISENSE/VSENSE switches on j314 (Martin Povišer) - ASoC: tas2764: Add optional 'Apple quirks' (Martin Povišer) - ASoC: macaudio: Add 'Speakers Up Indicator' control (Martin Povišer) - ASoC: macaudio: Remove stale 'speaker_nchans' fields (Martin Povišer) - ASoC: tas2764: Crop SDOUT zero-out mask based on BCLK ratio (Martin Povišer) - ASoC: tas2764: Export 'die_temp' to sysfs (Martin Povišer) - ASoC: tas2770: Export 'die_temp' to sysfs (Martin Povišer) - ASoC: tas2764: Raise regmap range maximum (Martin Povišer) - WIP: ASoC: tas2764: Apply unknown Apple quirk (Martin Povišer) - ASoC: tas2764: Configure zeroing of SDOUT slots (Martin Povišer) - ASoC: apple: mca: Support capture on multiples BEs (Martin Povišer) - ASoC: macaudio: Tune constraining of FEs, add BCLK (Martin Povišer) - NOT UPSTREAMABLE: ASoC: tas2764: Redo I/V sense logic (Martin Povišer) - ASoC: tas2764: Reinit cache on part reset (Martin Povišer) - ASoC: tas2770: Fix and redo I/V sense TDM slot setting logic (Martin Povišer) - ASoC: tas2770: Factor out set_ivsense_slots (Martin Povišer) - ASoC: macaudio: Do not constrain sense PCM (Martin Povišer) - ASoC: macaudio: Tweak "no audio route" message (Martin Povišer) - ASoC: macaudio: Start speaker sense capture support (Martin Povišer) - ASoC: apple: mca: Fix SYNCGEN enable on FE clock consumers (Martin Povišer) - ASoC: apple: mca: Support FEs being clock consumers (Martin Povišer) - ASoC: apple: mca: Factor out mca_be_get_fe (Martin Povišer) - ASoC: apple: mca: Separate data & clock port setup (Martin Povišer) - ASoC: macaudio: Tune DT parsing error messages (Martin Povišer) - ASoC: macaudio: Condition selecting NCO driver on COMMON_CLK (Martin Povišer) - ALSA: control: Add kcontrol callbacks for lock/unlock (Hector Martin) - ASoC: macaudio: alias j415 kcontrols to j314 (James Calligeros) - ASoC: apple: mca: Move clock shutdown to be shutdown (Hector Martin) - ASoC: cs42l42: Set a faster digital ramp-up rate (Hector Martin) - ASoC: macaudio: constrain frontend channel counts (James Calligeros) - ASoC: macaudio: Add initial j313 fixup_controls (Martin Povišer) - ASoC: macaudio: Improve message on opening of unrouted PCM devices (Martin Povišer) - ASoC: apple: mca: Constrain channels according to TDM mask (Martin Povišer) - ASoC: macaudio: Alias f413 fixups to j314 (Hector Martin) - ASoC: macaudio: Gate off experimental platforms (Hector Martin) - ASoC: macaudio: s/void_warranty/please_blow_up_my_speakers/ (Hector Martin) - ASoC: macaudio: s/Freq/Frequency/ in TAS2764 control (Martin Povišer) - ASoC: macaudio: Drop the 'inverse jack' speaker stuff (Martin Povišer) - ASoC: macaudio: Rename ALSA driver to simple 'macaudio' (Martin Povišer) - ASoC: macaudio: Add j493 fixup_controls (Martin Povišer) - ASoC: macaudio: Add j375 fixup_controls (Martin Povišer) - ASoC: dapm: Export new 'graph.dot' file in debugfs (Martin Povišer) - ASoC: macaudio: Fix headset routes (Martin Povišer) - ASoC: cs42l42: Do not advertise sample bit symmetry (Martin Povišer) - ASoC: cs42l42: Fix typo (Martin Povišer) - ASoC: apple: Add macaudio machine driver (Martin Povišer) - dt-bindings: sound: Add Apple Macs sound peripherals (Martin Povišer) - ASoC: card: Let 'fixup_controls' return errors (Martin Povišer) - ASoC: ops: Introduce 'soc_set_enum_kctl' (Martin Povišer) - ASoC: ops: Introduce 'snd_soc_deactivate_kctl' (Martin Povišer) - ASoC: ops: Accept patterns in snd_soc_limit_volume (Martin Povišer) - ASoC: ops: Enforce platform maximum on initial value (Martin Povišer) - ASoC: ops: Move guts out of snd_soc_limit_volume (Martin Povišer) - ASoC: tas2764: Add control concerning overcurrent events (Martin Povišer) - ASoC: tas2764: Extend driver to SN012776 (Martin Povišer) - Revert "ASoC: ops: Don't modify the driver's plaform_max when reading state" (Martin Povišer) - apple-nvme: defer cache flushes by a specified amount (Jens Axboe) - MAINTAINERS: Add Apple dwc3 bindings to ARM/APPLE (Hector Martin) - usb: dwc3: core: Allow phy suspend during init for role_switch_reset_quirk (Janne Grunau) - usb: dwc3: apple: Do not use host-vbus-glitches workaround (Janne Grunau) - usb: dwc3: Add support for Apple DWC3 (Sven Peter) - dt-bindings: usb: Add Apple dwc3 bindings (Sven Peter) - mmc: pci: gl9755: Quirk UHS-2 for Apple GL9755 (Janne Grunau) - mmc: sdhci-uhs2: Add quirk for devices with broken UHS-2 (Janne Grunau) - mmc: core: Skip SD UHS-II enumeration on missing UHS2 cap (Janne Grunau) - of: Workaround missing '#{address,size}-cells' properties [drop v6.13 + 2] (Janne Grunau) - Increase MAX_LOCKDEP_CHAIN_HLOCKS (Asahi Lina) - arm64: Increase kernel stack size to 32K (Asahi Lina) - drm/simpledrm: Set DMA and coherency mask (Janne Grunau) - HACK: Lol libwebrtc (Hector Martin) - soc: apple: apple-pmgr-pwrstate: Mark on-at-boot PDs as wakeup (Hector Martin) - tty: serial: samsung_tty: Mark as wakeup_path on no_console_suspend (Hector Martin) - soc: apple: apple-pmgr-pwrstate: Mark on-at-boot PDs as DEFER_OFF (Hector Martin) - PM: domains: Add a flag to defer power-off until all consumers probe (Hector Martin) - driver core: fw_devlink: Add fw_devlink_count_absent_consumers() (Hector Martin) - i2c: pasemi: Log bus reset causes (Hector Martin) - i2c: pasemi: Enable the unjam machine (Hector Martin) - usb: typec: tipd: Be more verbose about errors (Hector Martin) - i2c: pasemi: Improve timeout handling and error recovery (Hector Martin) - firmware_loader: Add /lib/firmware/vendor path (Hector Martin) - PCI: apple: Add depends on PAGE_SIZE_16KB (Janne Grunau) - mmc: sdhci-pci: Support setting CD debounce delay (Hector Martin) - mmc: sdhci-pci: Support external CD GPIO on all OF systems (Hector Martin) - of: Demote "Bad cell count" to debug message (Hector Martin) - tty: serial: samsung_tty: Support runtime PM (Hector Martin) - arm64: Enable IMP DEF PMUv3 traps on Apple M* (Oliver Upton) - KVM: arm64: Provide 1 event counter on IMPDEF hardware (Oliver Upton) - drivers/perf: apple_m1: Provide helper for mapping PMUv3 events (Oliver Upton) - KVM: arm64: Remap PMUv3 events onto hardware (Oliver Upton) - KVM: arm64: Advertise PMUv3 if IMPDEF traps are present (Oliver Upton) - KVM: arm64: Compute synthetic sysreg ESR for Apple PMUv3 traps (Oliver Upton) - KVM: arm64: Move PMUVer filtering into KVM code (Oliver Upton) - KVM: arm64: Use guard() to cleanup usage of arm_pmus_lock (Oliver Upton) - KVM: arm64: Drop kvm_arm_pmu_available static key (Oliver Upton) - KVM: arm64: Use a cpucap to determine if system supports FEAT_PMUv3 (Oliver Upton) - KVM: arm64: Always support SW_INCR PMU event (Oliver Upton) - KVM: arm64: Compute PMCEID from arm_pmu's event bitmaps (Oliver Upton) - drivers/perf: apple_m1: Support host/guest event filtering (Oliver Upton) - drivers/perf: apple_m1: Refactor event select/filter configuration (Oliver Upton) - iommu: apple-dart: Revert separate iommu_ops for locked/bypass DARTs (Janne Grunau) - iommu: apple-dart: Disallow identity domains for locked DARTs (Janne Grunau) - iommu: apple-dart: Support combinations of locked and unlocked DARTs (Janne Grunau) - fixup! iommu/dart: Support locked DARTs (Janne Grunau) - fixup! iommu/dart: Track if the DART is locked (Janne Grunau) - iommu/of: Free fwspec on probe deferrel (Janne Grunau) - iommu: apple-dart: Check for fwspec in the device probe path (Hector Martin) - iommu: apple-dart: Support specifying the DMA aperture in the DT (Hector Martin) - iommu: apple-dart: Add 4-level page table support (Hector Martin) - iommu: apple-dart: Make the hw register fields u32s (Hector Martin) - iommu: apple-dart: Clear stream error indicator bits for T8110 DARTs (Hector Martin) - iommu: io-pgtable: Add 4-level page table support (Hector Martin) - iommu: apple-dart: Enable runtime PM (Hector Martin) - iommu: apple-dart: Link to consumers with blanket RPM_ACTIVE (Martin Povišer) - iommu: apple-dart: Power on device when handling IRQs (Asahi Lina) - iommu: Handle translated device firmware mappings (Janne Grunau) - iommu: Rename iommu_create_device_direct_mappings() (Janne Grunau) - iommu: Parse translated reserved regions (Janne Grunau) - iommu: Add IOMMU_RESV_TRANSLATED for non 1:1 mapped reserved regions (Janne Grunau) - iommu/dart: Support locked DARTs (Alyssa Rosenzweig) - iommu/dart: Add iommu_ops for locked DARTs (Janne Grunau) - iommu/dart: Track if the DART is locked (Alyssa Rosenzweig) - iommu/dart: Use virtual memory ttbr entries in apple_dart_cfg (Janne Grunau) - iommu/dart: Use separate iommu_ops for DARTs w/o bypass (Janne Grunau) - iommu: apple-dart: fix potential null pointer deref (Qasim Ijaz) - iommu: apple-dart: Allow mismatched bypass support (Hector Martin) - iommu: apple-dart: Increase MAX_DARTS_PER_DEVICE to 3 (Hector Martin) - irqchip/apple-aic: Add support for AICv3 (Janne Grunau) - soc: apple: rtkit: Pass 0 as size for a NULL crashlog buffer (Janne Grunau) - soc: apple: rtkit: Use scope-based cleanup in apple_rtkit_crashlog_rx() (Janne Grunau) - soc: apple: rtkit: Fix use-after-free in apple_rtkit_crashlog_rx() (Harshit Mogalapalli) - cpuidle: apple: Do not load on unsupported Apple platforms (Janne Grunau) - cpuidle: apple: Add Apple SoC cpuidle driver (Hector Martin) - soc: apple: pmgr: Add externally-clocked property (Hector Martin) - soc: apple: pmgr: Add force-disable/force-reset (Asahi Lina) - dt-bindings: power: apple,pmgr-pwrstate: Add force-{disable,reset} (Asahi Lina) - soc: apple: Add driver for Apple PMGR misc controls (Hector Martin) - soc: apple: rtkit: Cut syslog messages after the first '\0' (Janne Grunau) - soc: apple: rtkit: Use high prio work queue (Janne Grunau) - soc: apple: rtkit: Add devm_apple_rtkit_free() (Janne Grunau) - soc: apple: rtkit: Implement OSLog buffers properly (Hector Martin) - soc: apple: rtkit: Add APPLE_RTKIT_PWR_STATE_INIT (Janne Grunau) - soc: apple: rtkit: Log failed buffer requests (Asahi Lina) - soc: apple: rtkit: Log failure to send messages (Asahi Lina) - soc: apple: rtkit: Check for failure to send mgmt messages & log (Asahi Lina) - watchdog: apple: set max_hw_heartbeat_ms instead of max_timeout (Florian Klink) - arm64: dts: apple: Move PCIe-GE nodes intro their own file (Janne Grunau) - arm64: dts: apple: t6022-j180d: Delete non pcie-ge nodes (Janne Grunau) - arm64: dts: apple: touchbar: Mark ps_dispdfr_be as always-on (Janne Grunau) - arm64: dts: apple: t6022-j180d: Enable second HDMI port (Janne Grunau) - arm64: dts: apple: t6022-j180d: Add node for built-in PCIe devices (Janne Grunau) - arm64: dts: apple: t6022-j180d: Probe all PCIe devices (Janne Grunau) - arm64: dts: apple: aop: Add hack to enforce probe order (Janne Grunau) - arm64: dts: apple: t8103-j45x: Mark missing beamforming (Janne Grunau) - arm64: dts: apple: t8112-j493: Enable AOP (Janne Grunau) - arm64: dts: apple: t8112-j415: Enable AOP (Janne Grunau) - arm64: dts: apple: t8112-j413: Enable AOP (Janne Grunau) - arm64: dts: apple: t8103-j45x: Enable AOP (Janne Grunau) - arm64: dts: apple: t8103-j313: Enable AOP (Janne Grunau) - arm64: dts: apple: t8103-j293: Enable AOP (Janne Grunau) - arm64: dts: apple: t600x-j314-j316: Enable AOP (Janne Grunau) - arm64: dts: apple: Remove no-map from remaining agx regions (Asahi Lina) - arm64: dts: apple: Remove no-map from pagetables region (Asahi Lina) - arm64: dts: apple: Add AOP audio identifiers (Sasha Finkelstein) - arm64: dts: apple: Add SEP device tree nodes (Sasha Finkelstein) - arm64: dts: apple: Add AOP and subdevices (Sasha Finkelstein) - arm64: dts: apple: j474s: correct case of Mac mini (Jonathan Gray) - arm64: dts: apple: t602x-j4xx: Add SMC hwmon sensors (Janne Grunau) - arm64: dts: apple: t600x-j3xx: Add SMC hwmon sensors (Janne Grunau) - arm64: dts: apple: t8112: Add SMC hwmon sensors (Janne Grunau) - arm64: dts: apple: t8103: Add SMC hwmon sensors (Janne Grunau) - arm64: dts: apple: add common hwmon keys and fans (James Calligeros) - arm64: apple: t8112-j473: Enable sio explicitly (Janne Grunau) - arm64: apple: t8103-j274: Enable sio explicitly (Janne Grunau) - arm64: apple: t60x0/t60x1: Enable sio explicitly (Janne Grunau) - arm64: apple: t60xx: Enable DP/HMI audio nodes on all devices (Janne Grunau) - arm64: apple: t602x: Add sio and dpaudio device nodes (Janne Grunau) - arm64: apple: t600x: Add sio and dpaudio device nodes (Janne Grunau) - arm64: apple: t600x: Move dart_sio* to dieX (Janne Grunau) - arm64: apple: t8112: Add SIO, DPA nodes; hook up to DCP (Janne Grunau) - arm64: apple: t8103: Add SIO, DPA nodes; hook up to DCP (Martin Povišer) - arm64: apple: t602x: pmgr: SIO: Add audio, spi and uart power-domains (Janne Grunau) - arm64: apple: t600x: pmgr: SIO: Add audio, spi and uart power-domains (Janne Grunau) - arm64: apple: t8112-pmgr: SIO: Add audio, spi and uart power-domains (Janne Grunau) - arm64: apple: t8103-pmgr: SIO: Add audio, spi and uart power-domains (Martin Povišer) - arm64: dts: apple: t8112-j473: Use dcpext for HDMI out (Janne Grunau) - arm64: dts: apple: j474s/j475c: Use dcpext0 for HDMI out (Janne Grunau) - arm64: dts: apple: Fill device node for dp2hdmi on Macbook Pros (Janne Grunau) - arm64: dts: apple: t6022-{j180,j475}: Enable dcpext0/dptx-phy/dp2hdmi (Janne Grunau) - arm64: dts: apple: t6020-j474,t6021-j475: Enable dcp/dptx-phy/dp2hdmi (Janne Grunau) - arm64: dts: apple: t8112-j473: Enable dcp/dptx-phy/dp2hdmi (Janne Grunau) - arm64: dts: apple: t602x: Add device nodes for atc DP crossbar (Janne Grunau) - arm64: dts: apple: t600x: Add device nodes for atc DP crossbar (Janne Grunau) - arm64: dts: apple: t602x: Add lpdptx-phy node (Janne Grunau) - arm64: dts: apple: t8112: Add dptx-phy node (Janne Grunau) - arm64: dts: apple: t602x: Add t6020 dispext device nodes (Janne Grunau) - arm64: dts: apple: t600x: Add t6000 dispext device nodes (Janne Grunau) - arm64: dts: apple: t8112: Add dcpext/dispext0 nodes (Janne Grunau) - arm64: dts: apple: t8103: Add dcpext/dispext0 nodes (Janne Grunau) - arm64: dts: apple: t602x: Add "apple,min-state" to ps_dispextN_cpu0 (Janne Grunau) - arm64: dts: apple: t600x: Add "apple,min-state" to ps_dispextN_cpu0 (Janne Grunau) - arm64: dts: apple: t8112: Switch to apple,dma-range (Janne Grunau) - arm64: dts: apple: t8103: Switch to apple,dma-range (Janne Grunau) - arm64: dts: apple: t600x: Switch to apple,dma-range (Janne Grunau) - arm64: dts: apple: Disable ps_isp_sys unless it is used (Janne Grunau) - arm64: dts: apple: add opp-microwatt to t8103/t600x (James Calligeros) - arm64: dts: apple: j313: Model SDZ GPIO as a regulator (Hector Martin) - arm64: dts: apple: j293: Model SDZ GPIO as a regulator (Hector Martin) - arm64: dts: apple: describe shared SDZ GPIO for tas2764 (James Calligeros) - arm64: dts: apple: j493: Enable speakers (Hector Martin) - arm64: dts: apple: j313: Enable speakers (Hector Martin) - arm64: dts: apple: j293: Enable speakers (Hector Martin) - arm64: dts: apple: j375 & friends: Enable speakers (Hector Martin) - arm64: dts: apple: t600x-j314-j316: Set sound compatibles per device (Hector Martin) - arm64: dts: apple: j413: Model SDZ GPIO as a regulator (Hector Martin) - arm64: dts: apple: j493: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j415: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j413: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j313: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j293: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j375: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j415: Enable speakers (Hector Martin) - arm64: dts: apple: j413: Enable speakers (Hector Martin) - arm64: dts: apple: j314/j316: Enable speakers (Hector Martin) - arm64: dts: apple: t8103-j313: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t8103-j293: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t8112-j493: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t8112-j473: Add I/VMON slots to amp (Hector Martin) - arm64: dts: apple: t8112-j415: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t8112-j413: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t600x-j180d: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t600x-j375: Add I/VMON slots to amp (Hector Martin) - arm64: dts: apple: t8112: Mark MCA power states as externally-clocked (Hector Martin) - arm64: dts: apple: t8103: Mark MCA power states as externally-clocked (Hector Martin) - arm64: dts: apple: t602x: Mark MCA power states as externally-clocked (Hector Martin) - arm64: dts: apple: t600x: Mark MCA power states as externally-clocked (Hector Martin) - arm64: dts: apple: t600x-j314-j316: Zero out unused speaker sense slots (Martin Povišer) - arm64: dts: apple: t600x-j314-j316: Add speaker I/V sense slots (Martin Povišer) - arm64: dts: apple: t8103-j274: Add speaker I/V sense slots (Martin Povišer) - arm64: dts: apple: imx558: Add downscaled resolution presets (Hector Martin) - arm64: dts: apple: imx248: Add scaled and cropped presets (Janne Grunau) - arm64: dts: ISP platform configs (Asahi Lina) - arm64: dts: apple: t602x: Add ISP nodes (Asahi Lina) - arm64: dts: apple: t8112: Add ISP nodes (Hector Martin) - arm64: dts: apple: t6000: Add ISP nodes (Eileen Yoon) - arm64: dts: apple: t8103: Add ISP nodes (Eileen Yoon) - arm64: dts: apple: t8112: Add nvram alias (Hector Martin) - arm64: dts: apple: t8103: Add nvram alias (Hector Martin) - arm64: dts: apple: t6022-j180.dtsi: Add spi nor flash and nvram partition (Janne Grunau) - arm64: dts: apple: t600x-j375.dtsi: Add spi nor flash and nvram partition (Janne Grunau) - arm64: dts: apple: t8112: add opp-microwatt props to avalanche/blizzard (James Calligeros) - arm64: dts: apple: t6020x: Mark dptx_phy_ps only on laptops always-on (Janne Grunau) - arm64: dts: apple: t8112-j473: Add dptx-phy power-domain (Janne Grunau) - arm64: dts: apple: t602x: Add initial Mac Studio (2023) device trees (Janne Grunau) - arm64: dts: apple: t6020-j474s: Disable dcp until lpdpphy is supported (Janne Grunau) - arm64: dts: apple: t6022: Disable dcp thouroughly (Janne Grunau) - arm64: dts: apple: Share USB-C port node on t6022 devices (Janne Grunau) - arm64: dts: apple: t8112-j473: Set GPU base pstate (Asahi Lina) - arm64: dts: apple: Add devicetree for Macbook Air (15-inch, M2, 2023) (Janne Grunau) - arm64: dts: apple: t8112: Add touchbar digitizer node (Janne Grunau) - arm64: dts: apple: t6022: Add APCIE-GE nodes (Hector Martin) - arm64: dts: apple: Add j180d (Mac Pro 2023) device tree (Hector Martin) - arm64: dts: apple: Add initial t6022 support (Hector Martin) - arm64: dts: apple: t600x-j375.dtsi: Add missing etherhet0 alias (Hector Martin) - arm64: dts: apple: Add T602x GPU node (Asahi Lina) - arm64: dts: apple: t8112: Enable turbo CPU p-states (Hector Martin) - arm64: dts: apple: t8103: Enable turbo CPU p-states (Hector Martin) - arm64: dts: apple: t600x: Enable turbo CPU p-states (Hector Martin) - arm64: dts: apple: Make ps_msg always-on (Hector Martin) - arm64: dts: apple: t600x: Remove obsolete comment in ans2 power domain (Hector Martin) - arm64: dts: apple: Add pmgr-misc nodes to t60xx (Hector Martin) - DO NOT SUBMIT: arm64: dts: apple: t6020-j474s: Add unused PCIe port01 (Janne Grunau) - arm64: dts: apple: Add identity dma-ranges mapping (Hector Martin) - arm64: dts: apple: Add MTP nodes to t6020x (Hector Martin) - arm64: dts: apple: Add initial t602x device trees (Hector Martin) - arm64: dts: apple: Fix t600x mca IRQs (Hector Martin) - arm64: dts: apple: Add keyboard alias & layout props for t8112 laptops (Hector Martin) - arm64: dts: apple: j314/j316: Disable ATC3_USB_AON power domain (Hector Martin) - arm64: dts: apple: t8112: Add "ps_disp0_cpu0" as resets for dcp (Janne Grunau) - arm64: dts: apple: t8103: Add "ps_disp0_cpu0" as resets for dcp (Janne Grunau) - arm64: dts: apple: t600x: Add "ps_disp0_cpu0" as resets for dcp (Janne Grunau) - arm64: dts: apple: t8103: Add missing ps_pmp dependency to ps_gfx (Janne Grunau) - arm64: dts: apple: t8112: Add DCP power domain to missing devices (Hector Martin) - arm64: dts: apple: t8103: Add DCP power domain to missing devices (Hector Martin) - arm64: dts: apple: t600x: Add DCP power domain to missing devices (Hector Martin) - arm64: dts: apple: Add GPU firmware versions to t8113/t600x (Asahi Lina) - arm64: dts: apple: Add GPU nodes to T8112 (Asahi Lina) - arm64: dts: apple: Add no-map to GPU reserved-memory nodes (Asahi Lina) - arm64: dts: t8103: Add GPU leak coefficients (Asahi Lina) - arm64: dts: Add t600x GPU nodes (Asahi Lina) - arm64: dts: Add power data for t8103 (Asahi Lina) - arm64: dts: Add GPU performance data to t8103.dts (Asahi Lina) - arm64: dts: apple: t8103*: Add GPU nodes (Asahi Lina) - scripts/dtc: Add support for floating-point literals (Asahi Lina) - arm64: dts: apple: t8112: Add dcp/disp0 nodes (Janne Grunau) - arm64: dts: apple: t8112: Add ATCPHY nodes (Janne Grunau) - arm64: dts: apple: t8112: Add eFuses node (Janne Grunau) - arch: arm64: apple: Add dcp panel node for t600x based laptops (Janne Grunau) - arch: arm64: apple: Add dcp panel node for t8103 based laptops and imacs (Janne Grunau) - arch: arm64: dts: apple: t600x: Add ATCPHY nodes (R) - arch: arm64: dts: apple: t6000: Add eFuses node (R) - arm64: dts: apple: t8103: Add ATCPHY node (Sven Peter) - arm64: dts: apple: t8103: Add eFuses node (Sven Peter) - arch: arm64: apple: t600x: Add connector type property for DCP* (Janne Grunau) - arch: arm64: apple: t8103: Add connector type property for DCP* (Janne Grunau) - arch: arm64: apple: t600x: Add display controller related device tree nodes (Janne Grunau) - arch: arm64: apple: Add display controller related device tree nodes (Hector Martin) - arch: arm64: apple: t600x: Mark USB and PCIe as "dma-coherent" (Janne Grunau) - arch: arm64: apple: Add missing power state deps for display (Janne Grunau) - arm64: dts: apple: t6001-j375c: Add USB3 hub GPIO initialization (Hector Martin) - arm64: dts: apple: Drop 'integrated audio' from sound models (Martin Povišer) - arm64: dts: apple: t600x-jxxx: Put in audio nodes (Martin Povišer) - arm64: dts: apple: t8103*: Put in audio nodes (Martin Povišer) - arm64: dts: apple: t600x: Add bluetooth device trees (Hector Martin) - arm64: dts: apple: Add PCI power enable GPIOs (Hector Martin) - arm64: dts: apple: Add WiFi module and antenna properties (Hector Martin) - arm64: dts: apple: t600x: Add dwc3 nodes (Janne Grunau) - arm64: dts: apple: j31[46]: Add keyboard nodes (Janne Grunau) - arm64: dts: apple: Add PMU NVMEM and SMC RTC/reboot nodes (Hector Martin) - arm64: dts: apple: Add SMC node to t600x devicetrees (Hector Martin) - arm64: dts: apple: Keep PCIe power domain on (Hector Martin) - arm64: dts: apple: Mark ATC USB AON domains as always-on (Hector Martin) - arm64: dts: apple: Add PMU NVMEM and SMC RTC/reboot nodes (Hector Martin) - arm64: dts: apple: Add SMC node to t8103/t6001 devicetrees (Hector Martin) - arm64: dts: apple: Add PCI power enable GPIOs (Hector Martin) - arm64: dts: apple: t8103: Add spi3 keyboard node (Janne Grunau) - arm64: dts: apple: t8103: Add dwc3 nodes (Hector Martin) - arm64: dts: apple: t8112: Add mtp device nodes for j413/j493 (Janne Grunau) - arm64: dts: apple: t8112: Add dwc3 nodes (Janne Grunau) - arm64: dts: apple: t8112*: Put in audio nodes (Martin Povišer) - arm64: dts: apple: t8112: Add SMC node to devicetree (Hector Martin) - arm64: dts: apple: t8112: Add PMU NVMEM and SMC RTC/reboot nodes (Hector Martin) - arm64: dts: apple: t8112: Add wlan/bt PCIe device nodes (Janne Grunau) - arm64: dts: apple: t8112: Remove always-on from the PMP node (Hector Martin) - arm64: dts: apple: t8015: Add backlight nodes (Nick Chan) - arm64: dts: apple: t8010: Add backlight nodes (Nick Chan) - arm64: dts: apple: s800-0-3: Add backlight nodes (Nick Chan) - arm64: dts: apple: t7000: Add backlight nodes (Nick Chan) - arm64: dts: apple: s5l8960x: Add backlight nodes (Nick Chan) - arm64: dts: apple: Add touchbar screen nodes (Sasha Finkelstein) - arm64: dts: apple: Add touchbar digitizer nodes (Sasha Finkelstein) - arm64: dts: apple: Add SPI NOR nvram partition to all devices (Janne Grunau) - arm64: dts: apple: t600x: Add spi controller nodes (Janne Grunau) - arm64: dts: apple: t8112: Add spi controller nodes (Janne Grunau) - arm64: dts: apple: t8103: Add spi controller nodes (Janne Grunau) - arm64: dts: apple: t8103: Fix spi4 power domain sort order (Hector Martin) - arm64: dts: apple: t7000: Add missing CPU p-state 7 for J96 and J97 (Nick Chan) - arm64: dts: apple: t8015: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: t8012: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: t8011: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: t8010: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: s8001: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: Add cpufreq nodes for S8000/S8003 (Nick Chan) - arm64: dts: apple: t7001: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: t7000: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: s5l8960x: Add cpufreq nodes (Nick Chan) - arm64: dts: apple: t8015: Add PMGR nodes (Nick Chan) - arm64: dts: apple: t8012: Add PMGR nodes (Nick Chan) - arm64: dts: apple: t8011: Add PMGR nodes (Nick Chan) - arm64: dts: apple: t8010: Add PMGR nodes (Nick Chan) - arm64: dts: apple: s8001: Add PMGR nodes (Nick Chan) - arm64: dts: apple: s800-0-3: Add PMGR nodes (Nick Chan) - arm64: dts: apple: t7001: Add PMGR node (Nick Chan) - arm64: dts: apple: t7000: Add PMGR node (Nick Chan) - arm64: dts: apple: s5l8960x: Add PMGR node (Nick Chan) - dt-bindings: arm: apple: apple,pmgr-pwrstate: Add A7-A11, T2 compatibles (Nick Chan) - dt-bindings: arm: apple: apple,pmgr: Add A7-A11, T2 compatibles (Nick Chan) - arm64: dts: apple: Add T2 devices (Nick Chan) - dt-bindings: arm: apple: Add T2 devices (Nick Chan) - arm64: dts: apple: Split s8000/s8003 SoC DTS files (Nick Chan) - soc: apple: rtkit: Pass the crashlog to the crashed() callback (Asahi Lina)- platform/x86/intel/pmc: Add Arrow Lake U/H support to intel_pmc_core driver (Xi Pardee) - platform/x86:intel/pmc: Move arch specific action to init function (Xi Pardee) - platform/x86/intel/pmc: Remove simple init functions (Xi Pardee) - platform/x86:intel/pmc: Create generic_core_init() for all platforms (Xi Pardee) - platform/x86/intel/pmc: Remove duplicate enum (Xi Pardee) - platform/x86:intel/pmc: Make tgl_core_generic_init() static (Xi Pardee) - redhat/configs: Add configs for new ov02c10 and ov02e10 drivers (Hans de Goede) - media: i2c: Add Omnivision OV02C10 sensor driver (Heimir Thor Sverrisson) - media: i2c: ov02e10: add OV02E10 image sensor driver (Jingjing Xiong) - platform/x86: int3472: Debug log when remapping pins (Hans de Goede) - platform/x86: int3472: Add handshake pin support (Hans de Goede) - platform/x86: int3472: Prepare for registering more than 1 GPIO regulator (Hans de Goede) - platform/x86: int3472: Avoid GPIO regulator spikes (Hans de Goede) - platform/x86: int3472: Make regulator supply name configurable (Hans de Goede) - platform/x86: int3472: Rework AVDD second sensor quirk handling (Hans de Goede) - platform/x86: int3472: Drop unused gpio field from struct int3472_gpio_regulator (Hans de Goede) - platform/x86: int3472: Stop setting a supply-name for GPIO regulators (Hans de Goede) - platform/x86: int3472: Add skl_int3472_register_clock() helper (Hans de Goede) - platform/x86: int3472: Call "func" "con_id" instead (Sakari Ailus) - Turn on ACPI_DEBUG for Fedora (Justin M. Forbes) - Linux v6.14.6- Fix up configs for 6.14.5 merge (Justin M. Forbes) - Turn off CONFIG_PCI_REALLOC_ENABLE_AUTO for Fedora (Justin M. Forbes) - Linux v6.14.5- Add F41 and F40 to release targets (Justin M. Forbes) - Linux v6.14.4- New configs for stable update (Justin M. Forbes) - Enable FunctionFS on aarch64 + x86 (Sam Day) - Turn on USB Gadget for Fedora x86 (Justin M. Forbes) - Linux v6.14.3- Config update for 6.14.2 (Justin M. Forbes) - Linux v6.14.2- Config updates for 6.14.1 (Justin M. Forbes) - redhat/kernel.spec: list python3-wheel explicitly for Fedora<42 (Jan Stancek) - serial: 8250_dma: terminate correct DMA in tx_dma_flush() (John Keeping) - serial: stm32: do not deassert RS485 RTS GPIO prematurely (Cheick Traore) - perf tools: Fix up some comments and code to properly use the event_source bus (Greg Kroah-Hartman) - memstick: rtsx_usb_ms: Fix slab-use-after-free in rtsx_usb_ms_drv_remove (Luo Qiu) - usb: xhci: Apply the link chain quirk on NEC isoc endpoints (Michal Pecio) - usb: xhci: Don't skip on Stopped - Length Invalid (Michal Pecio) - net: usb: usbnet: restore usb%d name exception for local mac addresses (Dominique Martinet) - net: usb: qmi_wwan: add Telit Cinterion FE990B composition (Fabio Porcedda) - net: usb: qmi_wwan: add Telit Cinterion FN990B composition (Fabio Porcedda) - tty: serial: fsl_lpuart: disable transmitter before changing RS485 related registers (Sherry Sun) - tty: serial: 8250: Add Brainboxes XC devices (Cameron Williams) - tty: serial: 8250: Add some more device IDs (Cameron Williams) - counter: microchip-tcb-capture: Fix undefined counter channel state on probe (William Breathitt Gray) - counter: stm32-lptimer-cnt: fix error handling when enabling (Fabrice Gasnier) - ALSA: hda/realtek: Bass speaker fixup for ASUS UM5606KA (Andres Traumann) - ALSA: hda/realtek: Support mute LED on HP Laptop 15s-du3xxx (Dhruv Deshpande) - netfilter: socket: Lookup orig tuple for IPv6 SNAT (Maxim Mikityanskiy) - cgroup/rstat: Fix forceidle time in cpu.stat (Abel Wu) - atm: Fix NULL pointer dereference (Minjoong Kim) - HID: hid-plantronics: Add mic mute mapping and generalize quirks (Terry Junge) - ALSA: usb-audio: Add quirk for Plantronics headsets to fix control names (Terry Junge) - Documentation/powerpc/fadump: add additional parameter feature details (Mamatha Inamdar) [RHEL-70827] - powerpc: increase MIN RMA size for CAS negotiation (Mamatha Inamdar) [RHEL-70827] - powerpc/fadump: fix additional param memory reservation for HASH MMU (Mamatha Inamdar) [RHEL-70827] - powerpc: export MIN RMA size (Mamatha Inamdar) [RHEL-70827] - fedora: arm64: move some TI drivers to modular (Peter Robinson) - fedora: minor cleanups for 6.14 (Peter Robinson) - Initial setup for stable Fedora releases (Justin M. Forbes) - powerpc64/ftrace: fix module loading without patchable function entries (Anthony Iliopoulos) - x86/insn_decoder_test: allow longer symbol-names (David Rheinsberg) - apply -Wno-error=unterminated-string-initialization temporarily (Thorsten Leemhuis) - Linux v6.14.1- Reset RHEL_RELEASE for 6.15 cycle (Justin M. Forbes)- arm64: cleanup and de-dupe erratum (Peter Robinson) - arm64: cleanup and de-dupe configs (Peter Robinson) - cleanup: x86: cleanup some x86_32 leftovers (Peter Robinson) - all: cleanup CAN_ROCKCHIP_CANFD (Peter Robinson) - aarch64: Options required for UEFI HTTP boot on SystemReady-DT (Peter Robinson) - common: Move ZONE_DEVICE to generic (Peter Robinson) - common: Cleanup BTT (Peter Robinson) - cleanup: move DEV_DAX_PMEM to common/generic (Peter Robinson) - generic: cleanup the NVDIMM options (Peter Robinson) - cleanup: move OF_PMEM to common/generic (Peter Robinson) - cleanup: Remove DEV_DAX_PMEM_COMPAT option (Peter Robinson) - mei: vsc: Fix fortify-panic caused by invalid counted_by() use (Hans de Goede) - Linux v6.14.0- Linux v6.14.0-0.rc7.586de92313fc- Consolidate configs into common for 6.14 (Justin M. Forbes) - Turn VIRTIO_BLK and VIRTIO_CONSOLE inline for Fedora (Justin M. Forbes) - Linux v6.14.0-0.rc7.88d324e69ea9- Linux v6.14.0-0.rc7.b3ee1e460951- Linux v6.14.0-0.rc7.a7f2e10ecd8f- redhat: configs: fedora: enable CONFIG_I2C_HID_OF=m on x86 (Hans de Goede) - redhat: move dist-relase-check behind new variable (Jan Stancek) - Set last minute config item for 6.14 for Fedora (Justin M. Forbes) - Linux v6.14.0-0.rc7.81e4f8d68c66- redhat/configs: automotive: Disable CONFIG_USERFAULTFD config (Dorinda Bassey) - Revert "be2iscsi: remove unsupported device IDs" (Scott Weaver) - Revert "megaraid_sas: remove deprecated pci-ids" (Scott Weaver) - Revert "[scsi] megaraid_sas: re-add certain pci-ids" (Scott Weaver) - media: ov08x40: Extend sleep after reset to 5 ms (Hans de Goede) - media: ov08x40: Log chip ID when identifying the chip (Hans de Goede) - media: ov08x40: Fix value of reset GPIO when requesting it (Hans de Goede) - redhat/configs: automotive: Disable VLAN_8021Q_GVRP config (Dorinda Bassey) - redhat/configs: automotive: Disable DCB and MPLS configs (Dorinda Bassey) - redhat/configs: automotive: Disable IEEE 802.15.4 config (Dorinda Bassey) - redhat/configs: automotive: Disable various network classification features (Dorinda Bassey) - redhat/configs: automotive: Disable the SMBFS file system (Dorinda Bassey) - redhat/configs: automotive: Disable Myricom network adapters (Dorinda Bassey) - redhat/configs: automotive: Disable USB4 Ethernet config (Dorinda Bassey) - redhat/configs: automotive: Disable the Mellanox SwitchX core driver (Dorinda Bassey) - redhat/configs: automotive: Disable network storage related protocols (Dorinda Bassey) - redhat/configs: automotive: Disable lightweight tunneling with BPF (Dorinda Bassey) - redhat/configs: automotive: Disable RADOS block device configs (Dorinda Bassey) - redhat/configs: automotive: Disable switchdev driver framework (Dorinda Bassey) - redhat/configs: automotive: Disable network packet generator (Dorinda Bassey) - redhat/configs: automotive: Disable NET_CLS_ACT and PSAMPLE configs (Dorinda Bassey) - redhat/configs: automotive: Disable BPF STREAM_PARSER (Dorinda Bassey) - redhat/configs: automotive: Disable Open vSwitch and NET_NSH configs (Dorinda Bassey) - redhat/configs: automotive: Disable IP Virtual Server configs (Dorinda Bassey) - redhat/configs: automotive: Disable IP set support (Dorinda Bassey) - redhat/configs: automotive: Disable NetLabel subsystem support (Dorinda Bassey) - redhat/configs: automotive: Disable TLS Protocol (Dorinda Bassey) - redhat/configs: automotive: Disable Advanced TCP Congestion Control (Dorinda Bassey) - redhat/configs: automotive: Disable XDP Socket Protocol (Dorinda Bassey) - redhat/configs: delete CONFIG_USB_ONBOARD_HUB and use CONFIG_USB_ONBOARD_DEV instead (Desnes Nunes) - redhat: check release commit is present for dist-{release-tag,git} (Jan Stancek) - Revert "qla4xxx: Remove deprecated PCI IDs from RHEL 8" (Scott Weaver) - Re-enable vxcan (CONFIG_CAN_VXCAN) for automotive (Radu Rendec) - Linux v6.14.0-0.rc7.76b6905c11fd- Linux v6.14.0-0.rc7- Linux v6.14.0-0.rc6.cb82ca153949- Linux v6.14.0-0.rc6.3571e8b091f4- Linux v6.14.0-0.rc6.695caca9345a- Revert "mpt*: remove certain deprecated pci-ids" (Scott Weaver) - Turn on CONFIG_PACKING for RHEL (Justin M. Forbes) - main.c: fix initcall blacklisted (Tomas Henzl) - redhat/configs: automotive: Disable IPsec Protocols and XFRM (Dorinda Bassey) - Linux v6.14.0-0.rc6.b7f94fcf5546- redhat: Update CONFIG_STRICT_DEVMEM settings (enable it on s390x) (Thomas Huth) - redhat: Consolidate CONFIG_VIRTIO_MEM and enable it also for s390x (Thomas Huth) - Remove no longer necessary pending entry (Justin M. Forbes) - Linux v6.14.0-0.rc6.0fed89a961ea- Fedora configs for 6.14 (Justin M. Forbes) - Linux v6.14.0-0.rc6.4d872d51bc9d- redhat/configs: Disable rest of the CONFIG_PKEY_ options on s390 (Mete Durlu) [RHEL-78341] - Linux v6.14.0-0.rc6- Fix up some debug module loading issues due to BTF mismatch (Justin M. Forbes) - Linux v6.14.0-0.rc5.2a520073e74f- Revert "redhat/configs: automotive: disable CONFIG_AIO" (Davide Caratti) - redhat/configs: automotive disable ARCH_TEGRA_241_SOC (Eric Chanudet) - rhel_files: ensure all qdiscs are in modules-core (Davide Caratti) [RHEL-79818] - redhat/configs: automotive: Disable MRP/8021Q_MVRP Protocol (Dorinda Bassey) - Linux v6.14.0-0.rc5.00a7d39898c8- Linux v6.14.0-0.rc5.848e07631744- redhat/configs: enable CONFIG_ARM_SMMU_MMU_500_CPRE_ERRATA (Jerry Snitselaar) - redhat/configs: enable CONFIG_ARM_SMMU_V3_IOMMUFD (Jerry Snitselaar) - redhat: configs: remove CONFIG_DMA_API_DEBUG_SG (Kate Hsuan) - Linux v6.14.0-0.rc5.48a5eed9ad58- Linux v6.14.0-0.rc5.99fa936e8e4f- Linux v6.14.0-0.rc5- Linux v6.14.0-0.rc4.ece144f151ac- Linux v6.14.0-0.rc4.03d38806a902- Linux v6.14.0-0.rc4.76544811c850- kernel.spec: add missing tools-libs on s390x (Jan Stancek) - arch/x86/kernel/setup.c: fix rh_check_supported (Tomas Henzl) - kernel.spec: add minimum version of setuptools for ynl (Jan Stancek) - Linux v6.14.0-0.rc4.dd83757f6e68- Linux v6.14.0-0.rc4.ac9c34d1e45a- Revert "Merge: redhat/configs: automotive: Disable POSIX_MQUEUE config (Dorinda Bassey) - redhat/configs: enable in kernel compression/decompression of compressed modules (Herton R. Krzesinski) - redhat: change compression flags for xz (Herton R. Krzesinski) - redhat/configs: automotive: Turn off ACPI Processor package for aarch64 (Enric Balletbo i Serra) - redhat/configs: automotive: Disable L2TP Protocol (Dorinda Bassey) - redhat/configs: automotive: Disable TIPC Protocol (Dorinda Bassey)- redhat/configs: Enable Mediatek Bluetooth USB drivers (Bastien Nocera) - redhat/configs: Disable CONFIG_PKEY for zfcpdump configs (Mete Durlu) [RHEL-78341] - Linux v6.14.0-0.rc4- Linux v6.14.0-0.rc3.27102b38b8ca- Linux v6.14.0-0.rc3.ff202c5028a1- Linux v6.14.0-0.rc3.334426094588- Linux v6.14.0-0.rc3.87a132e73910- redhat/configs: automotive: disable VFIO_PLATFORM (Eric Chanudet) - Revert "Merge: redhat/configs: automotive: Disable SYSIPC config" (Dorinda Bassey) - redhat/configs: Enable CONFIG_KASAN_INLINE for RT debug kernel (Waiman Long) - redhat/configs: Move CONFIG_PROVE_RAW_LOCK_NESTING to common/debug (Waiman Long) - redhat/configs: Move all the lock debugging Kconfig's to common (Waiman Long) - redhat/configs: Enable CONFIG_BLK_CGROUP_PUNT_BIO for RHEL (Neal Gompa) [RHEL-79711] - Linux v6.14.0-0.rc3.6537cfb395f3- fedora: pending: drop USB_ONBOARD_DEV_USB5744 (Peter Robinson) - Linux v6.14.0-0.rc3.2408a807bfc3- efi,lockdown: fix kernel lockdown on Secure Boot (Ondrej Mosnacek) {CVE-2025-1272} - Linux v6.14.0-0.rc3- Linux v6.14.0-0.rc2.ad1b832bf1cf- fedora: Update vbox drivers (Peter Robinson) - Drop the s390x CONFIG_REGMAP from RHEL pending as upstream removed the dep (Justin M. Forbes) - Linux v6.14.0-0.rc2.7ff71e6d9239- fedora: arm64: enable RT5616 codec (Marcin Juszkiewicz) - Linux v6.14.0-0.rc2.128c8f96eb86- Revert "nvme: Return BLK_STS_TARGET if the DNR bit is set" (Benjamin Marzinski) - Revert "nvme: allow local retry and proper failover for REQ_FAILFAST_TRANSPORT" (Benjamin Marzinski) - Revert "nvme: decouple basic ANA log page re-read support from native multipathing" (Benjamin Marzinski) - Revert "nvme: nvme_mpath_init remove multipath check" (Benjamin Marzinski) - redhat/configs: automotive: Disable CONFIG_FS_DAX config (Dorinda Bassey) - config: update CONFIG_LSM to match upstream (Ryan Sullivan) - redhat: configs: enable CONFIG_INTEL_ISH_FIRMWARE_DOWNLOADER for RHEL (David Arcari) - redhat/Makefile: Add help text for target dist-dump-variables (Eder Zulian) - media: ov08x40: Don't log ov08x40_check_hwcfg() errors twice (Hans de Goede) - media: ov08x40: Add missing '\n' to ov08x40_check_hwcfg() error messages (Hans de Goede) - media: ov08x40: Add missing ov08x40_identify_module() call on stream-start (Hans de Goede) - media: ov08x40: Improve ov08x40_[read|write]_reg() error returns (Hans de Goede) - media: ov08x40: Improve ov08x40_identify_module() error logging (Hans de Goede) - media: ov08x40: Move ov08x40_identify_module() function up (Hans de Goede) - media: ov08x40: Get clock on ACPI platforms too (Hans de Goede) - media: ov08x40: Get reset GPIO and regulators on ACPI platforms too (Hans de Goede) - media: ov08x40: Move fwnode_graph_get_next_endpoint() call up (Hans de Goede) - media: ov08x40: Properly turn sensor on/off when runtime-suspended (Hans de Goede) - redhat: update self-test-data for new default RHJOBS value (Patrick Talbert) - set a more reasonable default for number of jobs (Thorsten Leemhuis) - Linux v6.14.0-0.rc2.4dc1d1bec898- redhat: automotive: define CONFIG_RH_AUTOMOTIVE (Scott Weaver) - redhat/configs: disable CONFIG_TCP_AO on RHEL (Sabrina Dubroca) - Linux v6.14.0-0.rc2.09fbf3d50205- Linux v6.14.0-0.rc2.febbc555cf0f- Linux v6.14.0-0.rc2- Linux v6.14.0-0.rc1.9946eaf552b1- redhat/configs: amend USB_ONBOARD_DEV_USB5744 (Eric Chanudet) - redhat/configs: automotive: Disable SYSIPC and MQUEUE configs (Dorinda Bassey) - redhat: kernel.spec: add ynl to kernel-tools (Jan Stancek) - Linux v6.14.0-0.rc1.8f6629c004b1- fedora: enable USB device USB5744 (Peter Robinson) - Linux v6.14.0-0.rc1.bb066fe812d6- Linux v6.14.0-0.rc1.92514ef226f5- rhel: enable FW_CACHE on RHEL (Dave Airlie) - redhat/configs: automotive: Disable the SCTP Protocol (Dorinda Bassey) - Linux v6.14.0-0.rc1.5c8c229261f1- Linux v6.14.0-0.rc1.0de63bb7d919- redhat: generalize rule for kunit and test kmod placement (Jan Stancek) - Linux v6.14.0-0.rc1- Linux v6.14.0-0.rc0.a86bf2283d2c- Move CONFIG_PCI_REALLOC_ENABLE_AUTO out of common as they have diverged (Justin M. Forbes) - fedora: arm64: enable Silicon Mitus SM5502 Extcon driver (Sam Day) - fedora: arm64: enable Richtek RT5033 MFD+charger+regulator modules (Sam Day) - configs/fedora: Enable CONFIG_PCI_REALLOC_ENABLE_AUTO (Yanko Kaneti) - Enable CONFIG_INTEL_MEI_PXP and CONFIG_DRM_I915_PXP on rhel (Jocelyn Falempe) - Enable Intel Xe Graphics (Mika Penttilä) - Linux v6.14.0-0.rc0.60c828cf80c0- Turn on CONFIG_DRM_ACCEL_AMDXDNA for Fedora (Justin M. Forbes) - Linux v6.14.0-0.rc0.69e858e0b8b2- redhat/configs: disable CONFIG_AF_UNIX_OOB on RHEL (Marcelo Ricardo Leitner) - redhat/configs: automotive: Disable wireless network and it's dependencies (Dorinda Bassey) - Linux v6.14.0-0.rc0.72deda0abee6- Linux v6.14.0-0.rc0.05dbaf8dd8bf- redhat/kernel.spec: work around find-debuginfo aborting cross builds (Jan Stancek) - redhat/configs: Default to batched invalidation on s390 (Jerry Snitselaar) - Linux v6.14.0-0.rc0.6d61a53dd6f5- Linux v6.14.0-0.rc0.9c5968db9e62- redhat/configs: automotive: set CONFIG_TIMEOUT_PANIC (Enric Balletbo i Serra) - drop %{_datadir}/perf-core/* from kernel.spec (Thorsten Leemhuis) - put new misc_minor_kunit in modules-internal (Thorsten Leemhuis) - put new cirrus kunit tests in modules-internal (Thorsten Leemhuis) - redhat/configs: enable iBFT parsing on aarch64 (Chris Leech) - redhat: kernel.spec: fix build with merged-sbin (Zbigniew Jędrzejewski-Szmek)- Fix up CONFIG_REGMAP mismatch (Scott Weaver) - Linux v6.14.0-0.rc0.aa22f4da2a46- redhat: fix modules.order target (Scott Weaver) - Linux v6.14.0-0.rc0.bc8198dc7ebc- Fix up CONFIG_CRC_T10DIF_IMPL_GENERIC mismatch (Justin M. Forbes) - Fix mismatches for 6.13 merge window (Justin M. Forbes) - Linux v6.14.0-0.rc0.d0d106a2bd21- Reset rhelver and trim changelog for 6.14 (Justin M. Forbes) - Linux v6.14.0-0.rc0.c4b9570cfb63- Turn off CONFIG_ARM_TIMER_SP804 for automotive (Justin M. Forbes) - Set ARM_TIMER_SP804 (Justin M. Forbes) - redhat/configs: enable addtional sa8775 related Kconfigs (Brian Masney) - redhat: Add rustfmt to deps (Peter Robinson) - redhat/configs: Disable deprecated CONFIG_LCS option on s390 (Mete Durlu) [RHEL-68296] - redhat/configs: make modular/disable NFS support (Dorinda Bassey) - redhat/configs: Disable unsafe queuing disciplines (Dorinda Bassey) - configs: move pending RT configs into rhel/rt/generic (Clark Williams) - Turn on PROVE_RAW_LOCK_NESTING for RHEL debug builds (Justin M. Forbes) - redhat/Makefile: Fix long dist-full-help execution time (Prarit Bhargava) - redhat/self-test: Update data to add HELP_TYPES variable (Prarit Bhargava) - redhat/Makefile: Add new dist-help functionality (Prarit Bhargava) - Makefile: Do not output LOCALVERSION message for help commands (Prarit Bhargava) - Fedora 6.13 configs part 2 (Justin M. Forbes) - Fedora 6.13 configs part 1 (Justin M. Forbes) - redhat/configs: enable CONFIG_VFAT_FS as a module (Dorinda Bassey) - redhat: create 'debug' addon for UKI (Li Tian) - kernel.spec: Build cpupower on riscv64 (Yanko Kaneti) - RHEL: Set correct config option for CRYPTO_HMAC_S390 (Mete Durlu) [RHEL-24137] - redhat/kernel.spec: add iputils to the requires list for selftests-internal (Brian Masney) - redhat/kernel.spec.template: Require kernel-tools-libs in rtla (Tomas Glozar) - redhat: make kernel-debug-uki-virt installable without kernel-debug-core (Vitaly Kuznetsov) - redhat/configs: enable CONFIG_USB_XHCI_PCI_RENESAS on RHEL (Desnes Nunes) [RHEL-72093] - redhat/configs: Re-enable ZRAM backends and unify configuration (Neal Gompa) - redhat/configs: automotive: disable CONFIG_AIO (Davide Caratti) - redhat/configs: Re-enable CONFIG_INFINIBAND_VMWARE_PVRDMA (Vitaly Kuznetsov) - redhat/configs: PREEMPT_NOTIFIERS does not need to be explicitly listed (Michal Schmidt) - redhat/configs: delete all CONFIG_PREEMPT_*BEHAVIOUR (Michal Schmidt) - redhat/configs: automotive: disable CONFIG_NET_DROP_MONITOR (Davide Caratti) - redhat/configs: Enable the CS42L84 driver on Fedora (Neal Gompa) - generic: Remove and cleanups from staging 6.13 (Peter Robinson) - redhat: configs: Clean up DVB settings in RHEL (Kate Hsuan) - Move CONFIG_ARCH_TEGRA_241_SOC config/common so that it is enabled for RHEL as well as Fedora. Get rid of uneeded CONFIG_TEGRA241_CMDQV in configs/fedora while we're at it. (Mark Salter) - fedora: arm64: Enable the rockchip HDMI QP support (Peter Robinson) - crypto: rng - Fix extrng EFAULT handling (Herbert Xu) - redhat: configs: rhel: aarch64: Support NV Jetson MIPI camera (Kate Hsuan) - gitlab-ci: disable clang CI pipelines (Scott Weaver) - redhat/configs: Remove obsolete arch64/64k/CONFIG_FORCE_MAX_ZONEORDER (Waiman Long) - Fix up QCOM_EMAC config for Fedora (Justin M. Forbes) - redhat/configs: automotive: disable CONFIG_IO_URING (Ian Mullins) - redhat/kernel.spec.template: Link rtla against in-tree libcpupower (Tomas Glozar) - redhat: configs: enable INTEL_PLR_TPMI for RHEL (David Arcari) - configs: Enable CONFIG_NETKIT for RHEL (Toke Høiland-Jørgensen) - redhat: fix build/install targets in netfilter kselftest (Davide Caratti) - RHEL: disable the btt driver (Jeff Moyer) - redhat/configs: default to PREEMPT_LAZY on x86, riscv (Michal Schmidt) - redhat/configs: New config CONFIG_PREEMPT_LAZY (Michal Schmidt) - crypto: sig - Disable signing (Herbert Xu) - redhat/configs: enable SERIAL_AMBA_PL011 for automotive (Radu Rendec) - c10s: disable tests in CKI pipelines (Michael Hofmann) - redhat: Drop bpftool from kernel spec (Viktor Malik) - Better fixes for the fedora mismatch (Justin M. Forbes) - Mismatch fix ups for Fedora (Justin M. Forbes) - redhat/configs: Enable Intel Bluetooth PCIE drivers (Bastien Nocera) - One more pending to fix a mismatch (Justin M. Forbes) - redhat: fix RT PREEMPT configs for Fedora and RHEL (Clark Williams) - Pending fixes to avoid mismatch for 6.13 (Justin M. Forbes) - Reset changelog for 6.13 (Justin M. Forbes) - Reset RHEL_RELEASE for 6.13 (Justin M. Forbes) - redhat: Move perf_dlfilter.h from libperf-devel to perf (Akihiko Odaki) - Consolidate configs to common for 6.12 (Justin M. Forbes) - redhat/configs: cleanup CONFIG_DEV_DAX (David Hildenbrand) - redhat/configs: cleanup CONFIG_TRANSPARENT_HUGEPAGE_MADVISE for Fedora (David Hildenbrand) - redhat/configs: cleanup CONFIG_TRANSPARENT_HUGEPAGE (David Hildenbrand) - redhat/configs: enable CONFIG_TRANSPARENT_HUGEPAGE on s390x in Fedora (David Hildenbrand) - redhat/configs: automotive: Enable j784s4evm am3359 tscadc configs (Joel Slebodnick) - redhat/configs: delete renamed CONFIG_MLX5_EN_MACSEC (Michal Schmidt) - rhel: disable DELL_RBU and cleanup related deps (Peter Robinson) - crypto: rng - Ensure stdrng is tested before user-space starts (Herbert Xu) - gitlab-ci: Add CKI_RETRIGGER_PIPELINE (Tales da Aparecida) - redhat: configs: disable the qla4xxx iSCSI driver (Chris Leech) [RHEL-1242] - Remove duplicated CONFIGs between automotive and RHEL (Julio Faracco) - redhat: update self-test data for addition of automotive (Scott Weaver) - gitlab-ci: enable automotive pipeline (Scott Weaver) - automotive: move pending configs to automotive/generic (Scott Weaver) - redhat/configs: change Renesas eMMC driver and dependencies to built-in (Radu Rendec) - redhat/configs: automotive: Remove automotive specific override CONFIG_OMAP2PLUS_MBOX By removing this automotive-specific override, the configuration will default to the common configuration (CONFIG_OMAP2PLUS_MBOX=m), which enables the driver as a module. (Martin McConnell) - Config enablement of the Renesas R-Car S4 SoC (Radu Rendec) [RHEL-44306] - redhat/configs: automotive: Enable USB_CDNS3_TI for TI platforms (Andrew Halaney) - redhat/configs: automotive: Enable j784s4evm SPI configs (Joel Slebodnick) - redhat/configs: automotive: Enable TPS6594 MFD (Joel Slebodnick) - redhat/configs: automotive: stop overriding CRYPTO_ECDH (Andrew Halaney) - redhat/configs: automotive: Enable PCI_J721E (Andrew Halaney) - redhat/configs: change some TI platform drivers to built-in (Enric Balletbo i Serra) - redhat/configs: automotive: Enable TI j784s4evm display dependencies (Andrew Halaney) - redhat/configs: automotive: match ark configs to cs9 main-automotive (Shawn Doherty) [RHEL-35995] - redhat/configs: automotive: Enable TI's watchdog driver (Andrew Halaney) - redhat/configs: automotive: Enable TI's UFS controller (Andrew Halaney) - redhat/configs: automotive: Enable networking on the J784S4EVM (Andrew Halaney) [RHEL-29245] - Disable unsupported kernel variants for automotive (Don Zickus) - Disable CONFIG_RTW88_22BU (Don Zickus) - redhat: Delete CONFIG_EFI_ZBOOT to use the common CONFIG (Julio Faracco) - redhat: Update automotive SPEC file with new standards (Julio Faracco) - redhat: Disable WERROR for automotive temporarily (Julio Faracco) - redhat: Update spec file with automotive macros (Julio Faracco) - redhat: Add automotive CONFIGs (Julio Faracco) - Fedora configs for 6.12 (Justin M. Forbes) - redhat/configs: Add CONFIG_CRYPTO_HMAC_S390 config (Mete Durlu) [RHEL-50799] - redhat: configs: common: generic: Clean up EM28XX that are masked behind CONFIG_VIDEO_EM28XX (Kate Hsuan) - redhat/configs: Update powerpc NR_CPUS config (Mamatha Inamdar) - redhat: use stricter rule for kunit.ko (Jan Stancek) - filtermod: fix clk kunit test and kunit location (Nico Pache) - redhat/configs: enable xr_serial on rhel (Desnes Nunes) - redhat/configs: enable ATH12K for rhel (Jose Ignacio Tornos Martinez) - redhat: configs: rhel: generic: x86: Enable IPU6 based MIPI cameras (Kate Hsuan) - os-build: enable CONFIG_SCHED_CLASS_EXT for RHEL (Phil Auld) - Fedora 6.12 configs part 1 (Justin M. Forbes) - redhat: set new gcov configs (Jan Stancek) - Don't ignore gitkeep files for ark-infra (Don Zickus) - redhat/kernel.spec: don't clear entire libdir when building tools (Jan Stancek) - redhat/configs: enable usbip for rhel (Jose Ignacio Tornos Martinez) - redhat: create 'crashkernel=' addons for UKI (Vitaly Kuznetsov) - redhat: avoid superfluous quotes in UKI cmdline addones (Vitaly Kuznetsov) - fedora: arm: updates for 6.12 (Peter Robinson) - redhat/configs: add bootconfig to kernel-tools package (Brian Masney) - Enable CONFIG_SECURITY_LANDLOCK for RHEL (Zbigniew Jędrzejewski-Szmek) [RHEL-8810] - redhat: configs: Drop CONFIG_MEMSTICK_REALTEK_PCI config option (Desnes Nunes) - Update the RHEL_DIFFERENCES help string (Don Zickus) - Put build framework for RT kernel in place for Fedora (Clark Williams) - generic: enable RPMB for all configs that enable MMC (Peter Robinson) - fedora: riscv: Don't override MMC platform defaults (Peter Robinson) - common: only enable on MMC_DW_BLUEFIELD (Peter Robinson) - fedora: aarch64: Stop overriding CONFIG_MMC defaults (Peter Robinson) - commong: The KS7010 driver has been removed (Peter Robinson) - Trim Changelog for 6.12 (Justin M. Forbes) - Enable CONFIG_SECURITY_IPE for Fedora (Zbigniew Jędrzejewski-Szmek) - redhat: allow to override VERSION_ON_UPSTREAM from command line (Jan Stancek) - redhat: configs: Enable CONFIG_SECURITY_TOMOYO in Fedora kernels (Tetsuo Handa) - Revert "Merge branch 'enablement/gpio-expander' into 'os-build'" (Justin M. Forbes) - redhat: configs: decrease CONFIG_PCP_BATCH_SCALE_MAX (Rafael Aquini) - redhat/configs: Enable CONFIG_RCU_TRACE in Fedora/REHL kernels (Waiman Long) - fedora: distable RTL8192E wifi driver (Peter Robinson) - common: arm64: Fixup and cleanup some SCMI options (Peter Robinson) - common: Cleanup ARM_SCMI_TRANSPORT options (Peter Robinson) - configs: fedora/x86: Set CONFIG_CRYPTO_DEV_CCP_DD=y (Hans de Goede) - Turn on ZRAM_WRITEBACK for Fedora (Justin M. Forbes) - configs: rhel: Fix designware I2C controllers related config settings (Hans de Goede) - Enable CONFIG_DMA_NUMA_CMA for x86_64 and aarch64 (Chris von Recklinghausen) - new config in drivers/phy (Izabela Bakollari) - configs: fedora: Unset CONFIG_I2C_DESIGNWARE_CORE on s390x (Hans de Goede) - configs: fedora: Drop duplicate CONFIG_I2C_DESIGNWARE_CORE for x86_64 and aarch64 (Hans de Goede) - Enable DESIGNWARE_CORE for ppc as well (Justin M. Forbes) - Fix up I2C_DESIGNWARE_CORE config for Fedora (Justin M. Forbes) - configs for RT deps (Clark Williams) - CONFIG_OF_OVERLAY: enable for aarch64 and powerpc (Scott Weaver) - redhat: enable changes to build rt variants (Clark Williams) - redhat: clean up pending-rhel (Patrick Talbert) - Enable CONFIG_SCHED_CLASS_EXT for Fedora (Jose Fernandez) - redhat/configs: new config in arch/s390 (Izabela Bakollari) - redhat: ignore rpminspect runpath report on selftests/bpf/cpuv4/urandom_read (Viktor Malik) - [fedora] configs: add end of file newline to CONFIG_DMADEVICES_VDEBUG (Patrick Talbert) - unset CONFIG_DMADEVICES_VDEBUG (cmurf) - stop installing tools/build/Build, gone with ea974028a049f (Thorsten Leemhuis) - redhat/configs: Update LOCKDEP configs (Waiman Long) - uki-virt: Add i18n module (Vitaly Kuznetsov) - uki-virt: Drop DBUS support from initramfs (Vitaly Kuznetsov) - uki-virt: Drop redundant modules from dracut-virt.conf (Vitaly Kuznetsov) - uki-virt: Drop usrmount dracut module (Vitaly Kuznetsov) - redhat: new AMCC_QT2025_PHY config in drivers/net/phy (Patrick Talbert) - redhat: change schedule jobs image from cki-tools to builder-rawhide (Patrick Talbert) - Add CONFIG_SND_SOC_RT1320_SDW to pending-rhel for mismatch (Justin M. Forbes) - Turn on CONFIG_SND_SOC_RT1320_SDW in pending rhel (Justin M. Forbes) - configs: disable CONFIG_AMCC_QT2025_PHY in pending (Patrick Talbert) - fedora: turn on CONFIG_FDMA for powerpc (Patrick Talbert) - Turn on CONFIG_FDMA in pending for Fedora arm and riscv to avoid a mismatch (Justin M. Forbes) - Reset RHEL_RELEASE for 6.12 (Justin M. Forbes) - Consolidate configs into common for 6.11 kernels (Justin M. Forbes) - uki-virt: add systemd-cryptsetup module (Vitaly Kuznetsov) - redhat/docs: fix command to install missing build dependencies (Davide Cavalca) - spec: Respect rpmbuild --without debuginfo (Orgad Shaneh) - fedora/configs: enable GPIO expander drivers (Rupinderjit Singh) - redhat/configs: Switch to the Rust implementation of AX88796B_PHY driver for Fedora (Neal Gompa) - redhat: Turn on support for Rust code in Fedora (Neal Gompa) - Turn off RUST for risc-v (Justin M. Forbes) - gitlab-ci: allow failure of clang LTO pipelines (Michael Hofmann) - redhat/configs: Consolidate the CONFIG_KVM_BOOK3S_HV_P*_TIMING switches (Thomas Huth) - redhat/configs: Consolidate the CONFIG_KVM_SW_PROTECTED_VM switch (Thomas Huth) - redhat/configs: Consolidate the CONFIG_KVM_HYPERV switch (Thomas Huth) - redhat/configs: Consolidate the CONFIG_KVM_AMD_SEV switch (Thomas Huth) - Cleanup some riscv CONFIG locations (Justin M. Forbes) - Fix up pending riscv Fedora configs post merge (Justin M. Forbes) - fedora/configs: Enable SCMI configuration (Rupinderjit Singh) - Remove S390 special config for PHYLIB (Justin M. Forbes) - Disable ELN for riscv64 (Isaiah Stapleton) - redhat: add checks to ensure only building riscv64 on fedora (Isaiah Stapleton) - redhat: Add missing riscv fedora configs (Isaiah Stapleton) - Add riscv64 to the CI pipelines (Isaiah Stapleton) - redhat: Regenerate dist-self-test-data for riscv64 (Isaiah Stapleton) - redhat: Add riscv config changes for fedora (David Abdurachmanov) - redhat: Add support for riscv (David Abdurachmanov) - redhat: Do not include UKI addons twice (Vitaly Kuznetsov) - redhat: update gating.yml (Michael Hofmann) - Remove CONFIG_FSCACHE_DEBUG as it has been renamed (Justin M. Forbes) - Set Fedora configs for 6.11 (Justin M. Forbes) - redhat/configs: Microchip lan743x driver (Izabela Bakollari) - redhat: include resolve_btfids in kernel-devel (Jan Stancek) - redhat: workaround CKI cross compilation for scripts (Jan Stancek) - spec: fix "unexpected argument to non-parametric macro" warnings (Jan Stancek) - Add weakdep support to the kernel spec (Justin M. Forbes) - redhat: configs: disable PF_KEY in RHEL (Sabrina Dubroca) - crypto: akcipher - Disable signing and decryption (Vladis Dronov) [RHEL-54183] {CVE-2023-6240} - crypto: dh - implement FIPS PCT (Vladis Dronov) [RHEL-54183] - crypto: ecdh - disallow plain "ecdh" usage in FIPS mode (Vladis Dronov) [RHEL-54183] - crypto: seqiv - flag instantiations as FIPS compliant (Vladis Dronov) [RHEL-54183] - [kernel] bpf: set default value for bpf_jit_harden (Artem Savkov) [RHEL-51896] - fedora: disable CONFIG_DRM_WERROR (Patrick Talbert) - redhat/configs: Disable dlm in rhel configs (Andrew Price) - rhel: aarch64: enable required PSCI configs (Peter Robinson) - fedora: Enable AF8133J Magnetometer driver (Peter Robinson) - redhat: spec: add cachestat kselftest (Eric Chanudet) - redhat: hmac sign the UKI for FIPS (Vitaly Kuznetsov) - not upstream: Disable vdso getrandom when FIPS is enabled (Herbert Xu) - kernel: config: enable erofs lzma compression (Ian Kent) - fedora: disable RTL8192CU in Fedora (Peter Robinson) - redhat: Fix the ownership of /lib/modules/ directory (Vitaly Kuznetsov) - new configs in drivers/phy (Izabela Bakollari) - Add support to rh_waived cmdline boot parameter (Ricardo Robaina) [RHEL-26170] - redhat/configs: Disable gfs2 in rhel configs (Andrew Price) - redhat/uki_addons/virt: add common FIPS addon (Emanuele Giuseppe Esposito) - redhat/kernel.spec: add uki_addons to create UKI kernel cmdline addons (Emanuele Giuseppe Esposito) - rh_flags: fix failed when register_sysctl_sz rh_flags_table to kernel (Ricardo Robaina) [RHEL-52629] - redhat/dracut-virt.conf: add systemd-veritysetup module (Emanuele Giuseppe Esposito) - redhat/configs: enable CONFIG_LOCK_STAT on the debug kernels for aarch64 (Brian Masney) - redhat/configs: enable CONFIG_KEYBOARD_GPIO_POLLED for RHEL on aarch64 (Luiz Capitulino) - redhat/configs: fedora: Enable new Qualcomm configs (Andrew Halaney) - redhat/configs/fedora: set CONFIG_CRYPTO_CURVE25519_PPC64 (Dan Horák) - fedora: Updates for 6.11 merge (Peter Robinson) - fedora: enable new mipi sensors and devices (Peter Robinson) - arm64: enable CRYPTO_DEV_TEGRA on RHEL (Peter Robinson) - redhat/kernel.spec: fix file listed twice warning for "kernel" subdir (Jan Stancek) - redhat/configs: Double MAX_LOCKDEP_ENTRIES for RT debug kernels (Waiman Long) [RHEL-43425] - Support the first day after a rebase (Don Zickus) - Support 2 digit versions properly (Don Zickus) - Automation cleanups for rebasing rt-devel and automotive-devel (Don Zickus) - fedora: set CONFIG_REGULATOR_RZG2L_VBCTRL as a module for arm64 (Patrick Talbert) - gitlab-ci: restore bot pipeline behavior (Michael Hofmann) - redhat/kernel.spec: drop extra right curly bracket in kernel_kvm_package (Jan Stancek) - redhat/configs: enable gpio_keys driver for RHEL on aarch64 (Luiz Capitulino) - Move NET_VENDOR_MICROCHIP from common to rhel (Justin M. Forbes) - redhat/configs: enable some RTCs for RHEL on aarch64 (Luiz Capitulino) - redhat/configs: enable some regulators for RHEL (Luiz Capitulino) - redhat/config: disable CXL and CXLFLASH drivers (Dan Horák) - Fix up config mismatches in pending (Justin M. Forbes) - redhat/configs: Enable watchdog devices modelled by qemu (Richard W.M. Jones) [RHEL-40937] - rhel: cleanup unused media tuner configs (Peter Robinson) - all: cleanup MEDIA_CONTROLLER options (Peter Robinson) - redhat: kernel.spec: add s390x to livepatching kselftest builds (Joe Lawrence) - Flip CONFIG_DIMLIB back to inline (Justin M. Forbes) - Add vfio/nvgrace-gpu driver CONFIG to RHEL-9.5 ARM64 (Donald Dutile) - Enable CONFIG_RTC_DRV_TEGRA for RHEL (Luiz Capitulino) - redhat: rh_flags: declare proper static methods when !CONFIG_RHEL_DIFFERENCES (Rafael Aquini) - redhat: configs: enable CONFIG_TMPFS_QUOTA for both Fedora and RHEL (Rafael Aquini) - Fix up mismatches in the 6.11 merge window. (Justin M. Forbes) - Reset Changelog after rebase (Justin M. Forbes) - Reset RHEL_RELEASE for the 6.11 cycle (Justin M. Forbes) - redhat/configs: Enable CONFIG_VMWARE_VMCI/CONFIG_VMWARE_VMCI_VSOCKETS for RHEL (Vitaly Kuznetsov) - Consolidate configs to common for 6.10 (Justin M. Forbes) - redhat/configs: Enable CONFIG_PTP_1588_CLOCK_MOCK in kernel-modules-internal (Davide Caratti) - fedora: enabled XE GPU drivers on all arches (Peter Robinson) - Flip SND_SOC_CS35L56_SPI from off to module for RHEL (Justin M. Forbes) - Flip DIMLIB from built-in to module for RHEL (Justin M. Forbes) - Also remove the zfcpdump BASE_SMALL config (Justin M. Forbes) - redhat: Add cgroup kselftests to kernel-selftests-internal (Waiman Long) [RHEL-43556] - Revert "redhat/configs: Disable CONFIG_INFINIBAND_HFI1 and CONFIG_INFINIBAND_RDMAVT" (Kamal Heib) - Remove new for GITLAB_TOKEN (Don Zickus) - Set Fedora configs for 6.10 (Justin M. Forbes) - Fedora: minor driver updates (Peter Robinson) - redhat/configs: Remove obsolete x86 CPU mitigations config files (Waiman Long) - redhat/configs: increase CONFIG_DEFAULT_MMAP_MIN_ADDR from 32K to 64K for aarch64 (Brian Masney) - redhat/configs: Re-enable CONFIG_KEXEC for Fedora (Philipp Rudo) - disable LR_WPAN for RHEL10 (Chris von Recklinghausen) [RHEL-40251] - Turn on USB_SERIAL_F81232 for Fedora (Justin M. Forbes) - redhat/scripts/filtermods.py: show all parent/child kmods in report (Jan Stancek) - redhat/kernel.spec: capture filtermods.py return code (Jan Stancek) - redhat/kernel.spec: fix run of mod-denylist (Jan Stancek) - gitlab-ci: remove unused RHMAINTAINERS variable (Michael Hofmann) - gitlab-ci: use environments for jobs that need access to push/gitlab secrets (Michael Hofmann) - gitlab-ci: default to os-build for all maintenance jobs (Michael Hofmann) - gitlab-ci: use the common git repo setup cki-gating as well (Michael Hofmann) - gitlab-ci: help maintenance jobs to cope with missing private key (Michael Hofmann) - gitlab-ci: use a common git repo setup for all maintenance jobs (Michael Hofmann) - gitlab-ci: move repo setup script into script template holder (Michael Hofmann) - gitlab-ci: move maintenance job DIST variable into common template (Michael Hofmann) - gitlab-ci: move maintenance job rules into common template (Michael Hofmann) - gitlab-ci: move maintenance job retry field into common template (Michael Hofmann) - gitlab-ci: provide common non-secret schedule trigger variables (Michael Hofmann) - gitlab-ci: rename .scheduled_setup to .git_setup (Michael Hofmann) - gitlab-ci: move script snippets into separate template (Michael Hofmann) - gitlab-ci: rename maintenance jobs (Michael Hofmann) - gitlab-ci: introduce job template for maintenance jobs (Michael Hofmann) - Turn on KASAN_HW_TAGS for Fedora aarch64 debug kernels (Justin M. Forbes) - redhat: kernel.spec: add missing sound/soc/sof/sof-audio.h to kernel-devel package (Jaroslav Kysela) - redhat/kernel.spec: fix attributes of symvers file (Jan Stancek) - redhat: add filtermods rule for iommu tests (Jan Stancek) - fedora: arm: Enable basic support for S32G-VNP-RDB3 board (Enric Balletbo i Serra) - redhat: make bnx2xx drivers unmaintained in rhel-10 (John Meneghini) [RHEL-36646 RHEL-41231] - redhat/configs: Disable CONFIG_NFP (Kamal Heib) [RHEL-36647] - Enable CONFIG_PWRSEQ_{SIMPLIE,EMMC} on aarch64 (Charles Mirabile) - Fix SERIAL_SC16IS7XX configs for Fedora (Justin M. Forbes) - Enable ALSA (CONFIG_SND) on aarch64 (Charles Mirabile) [RHEL-40411] - redhat: Remove DIST_BRANCH variable (Eder Zulian) - gitlab-ci: merge ark-latest before tagging cki-gating (Michael Hofmann) - gitlab-ci: do not merge ark-latest for gating pipelines for Rawhide (Michael Hofmann) - disable CONFIG_KVM_INTEL_PROVE_VE (Paolo Bonzini) - redhat: remove the merge subtrees script (Derek Barbosa) - redhat: rhdocs: delete .get_maintainer.conf (Derek Barbosa) - redhat: rhdocs: Remove the rhdocs directory (Derek Barbosa) - redhat/configs: Disable CONFIG_QLA3XXX (Kamal Heib) [RHEL-36646] - redhat/configs: fedora: Enable some drivers for IPU6 support (Hans de Goede) - redhat: add missing UKI_secureboot_cert hunk (Patrick Talbert) - redhat/kernel.spec: keep extra modules in original directories (Jan Stancek) - redhat/configs: Move CONFIG_BLK_CGROUP_IOCOST=y to common/generic (Waiman Long) - Turn on CONFIG_MFD_QCOM_PM8008 for Fedora aarch64 (Justin M. Forbes) - redhat: Build IMA CA certificate into the Fedora kernel (Coiby Xu) - Move CONFIG_RAS_FMPM to the proper location (Aristeu Rozanski) - redhat/configs: Remove CONFIG_NET_ACT_IPT (Ivan Vecera) - gitlab-ci: add kernel-automotive pipelines (Michael Hofmann) - Enable CEC support for TC358743 (Peter Robinson) - fedora: arm: Enable ARCH_R9A09G057 (Peter Robinson) - fedora: updates for the 6.10 kernel (Peter Robinson) - fedora: arm: Enable the MAX96706 GMSL module (Peter Robinson) - redhat: Switch UKI to using its own SecureBoot cert (from system-sb-certs) (Jan Stancek) - redhat: Add RHEL specifc .sbat section to UKI (Jan Stancek) - kernel.spec: add iommu selftests to kernel-selftests-internal (Eder Zulian) [RHEL-32895] - redhat/configs: fedora: aarch64: Re-enable CUSE (Neal Gompa) - redhat: pass correct RPM_VMLINUX_H to bpftool install (Jan Stancek) - rh_flags: Rename rh_features to rh_flags (Ricardo Robaina) [RHEL-32987] - kernel: rh_features: fix reading empty feature list from /proc (Ricardo Robaina) [RHEL-32987] - rh_features: move rh_features entry to sys/kernel (Ricardo Robaina) [RHEL-32987] - rh_features: convert to atomic allocation (Ricardo Robaina) [RHEL-32987] - add rh_features to /proc (Ricardo Robaina) [RHEL-32987] - add support for rh_features (Ricardo Robaina) [RHEL-32987] - Drop kexec_load syscall support (Baoquan He) - New configs in lib/kunit (Fedora Kernel Team) - Turn off KUNIT_FAULT_TEST as it causes problems for CI (Justin M. Forbes) - Add a config entry in pending for CONFIG_DRM_MSM_VALIDATE_XML (Justin M. Forbes) - Flip CONFIG_SND_SOC_CS35L56_SPI in pending to avoid a mismatch (Justin M. Forbes) - Fix up a mismatch for RHEL (Justin M. Forbes) - Reset changelog after rebase (Justin M. Forbes) - Reset RHEL_RELEASE to 0 for 6.10 (Justin M. Forbes) - configs: move CONFIG_BLK_DEV_UBLK into rhel/configs/generic (Ming Lei) - configs: move CONFIG_BLK_SED_OPAL into redhat/configs/common/generic (Ming Lei) - RHEL-21097: rhel: aarch64 stop blocking a number of HW sensors (Peter Robinson) - redhat/configs: enable RTL8822BU for rhel (Jose Ignacio Tornos Martinez) - redhat/configs: remove CONFIG_DMA_PERNUMA_CMA and switch CONFIG_DMA_NUMA_CMA off (Jerry Snitselaar) - redhat: add IMA certificates (Jan Stancek) - redhat/kernel.spec: fix typo in move_kmod_list() variable (Jan Stancek) - redhat: make filtermods.py less verbose by default (Jan Stancek) - scsi: sd: condition probe_type under RHEL_DIFFERENCES (Eric Chanudet) - scsi: sd: remove unused sd_probe_types (Eric Chanudet) - Turn on INIT_ON_ALLOC_DEFAULT_ON for Fedora (Justin M. Forbes) - Consolidate configs to common for 6.9 (Justin M. Forbes) - redhat/rhel_files: move tipc.ko and tipc_diag.ko to modules-extra (Xin Long) [RHEL-23931] - redhat: move amd-pstate-ut.ko to modules-internal (Jan Stancek) - redhat/configs: enable CONFIG_LEDS_TRIGGER_NETDEV also for RHEL (Michal Schmidt) [RHEL-32110] - redhat/configs: Remove CONFIG_AMD_IOMMU_V2 (Jerry Snitselaar) - Set DEBUG_INFO_BTF_MODULES for Fedora (Justin M. Forbes) - redhat: Use redhatsecureboot701 for ppc64le (Jan Stancek) - redhat: switch the kernel package to use certs from system-sb-certs (Jan Stancek) - redhat: replace redhatsecureboot303 signing key with redhatsecureboot601 (Jan Stancek) - redhat: drop certificates that were deprecated after GRUB's BootHole flaw (Jan Stancek) - redhat: correct file name of redhatsecurebootca1 (Jan Stancek) - redhat: align file names with names of signing keys for ppc and s390 (Jan Stancek) - redhat/configs: Enable CONFIG_DM_VDO in RHEL (Benjamin Marzinski) - redhat/configs: Enable DRM_NOUVEAU_GSP_DEFAULT everywhere (Neal Gompa) - kernel.spec: adjust for livepatching kselftests (Joe Lawrence) - redhat/configs: remove CONFIG_TEST_LIVEPATCH (Joe Lawrence) - Turn on CONFIG_RANDOM_KMALLOC_CACHES for Fedora (Justin M. Forbes) - Set Fedora configs for 6.9 (Justin M. Forbes) - gitlab-ci: enable pipelines with c10s buildroot (Michael Hofmann) - Turn on ISM for Fedora (Justin M. Forbes) - redhat/configs: enable CONFIG_TEST_LOCKUP for non-debug kernels (Čestmír Kalina) - redhat/rhel_files: add test_lockup.ko to modules-extra (Čestmír Kalina) - Turn off some Fedora UBSAN options to avoid false positives (Justin M. Forbes) - fedora: aarch64: Enable a QCom Robotics platforms requirements (Peter Robinson) - fedora: updates for 6.9 merge window (Peter Robinson) - gitlab-ci: rename GitLab jobs ark -> rawhide (Michael Hofmann) - gitlab-ci: harmonize DataWarehouse tree names (Michael Hofmann) - redhat/configs: Enable CONFIG_INTEL_IOMMU_SCALABLE_MODE_DEFAULT_ON for rhel (Jerry Snitselaar) - spec: make sure posttrans script doesn't fail if /boot is non-POSIX (glb) - Turn on UBSAN for Fedora (Justin M. Forbes) - Turn on XEN_BALLOON_MEMORY_HOTPLUG for Fedora (Justin M. Forbes) - docs: point out that python3-pyyaml is now required (Thorsten Leemhuis) - Use LLVM=1 for clang_lto build (Nikita Popov) - redhat: fix def_variants.yaml check (Jan Stancek) - redhat: sanity check yaml files (Jan Stancek) - spec: rework filter-mods and mod-denylist (Jan Stancek) - redhat/configs: remove CONFIG_INTEL_MENLOW as it is obsolete. (David Arcari) - arch/x86: Fix XSAVE check for x86_64-v2 check (Prarit Bhargava) - redhat/Makefile.variables: unquote a variable (Thorsten Leemhuis) - redhat/configs: build in Tegra210 SPI driver (Mark Salter) - redhat/configs: aarch64: Enable ARM_FFA driver (Mark Salter) - Base automotive-devel on rt-devel (Don Zickus) - redhat/configs: Enable CONFIG_AMDTEE for x86 (David Arcari) - redhat/configs: enable CONFIG_TEST_LOCKUP for debug kernel (Čestmír Kalina) - kernel.spec: fix libperf-debuginfo content (Jan Stancek) - Turn on DM_VDO for Fedora (Justin M. Forbes) - redhat: make libperf-devel require libperf %{version}-%{release} (Jan Stancek) - kernel.spec: drop custom mode also for System.map ghost entry (Jan Stancek) - Octopus merges are too conservative, serialize instead (Don Zickus) - Add tracking branches for rt-devel (Don Zickus) - all: clean-up i915 (Peter Robinson) - Turn on CONFIG_READ_ONLY_THP_FOR_FS for Fedora (Justin M. Forbes) - redhat/kernel.spec.template: fix rtonly build (Jan Stancek) - redhat/kernel.spec.template: add extra flags for tools build (Scott Weaver) - Add iio-test-gts to mod-internal.list (Thorsten Leemhuis) - redhat/kernel.spec.template: update license (Scott Weaver) - Fix typo in maintaining.rst file (Augusto Caringi) - Enable DRM_CDNS_DSI_J721E for fedora (Andrew Halaney) - gitlab-ci: do not merge ark-latest for gating pipelines (Michael Hofmann) - fedora: Enable MCP9600 (Peter Robinson) - redhat/configs: Enable & consolidate BF-3 drivers config (Luiz Capitulino) - redhat: Fix RT kernel kvm subpackage requires (Juri Lelli) - Add new of_test module to mod-internal.list (Thorsten Leemhuis) - Add new string kunit modules to mod-internal.list (Thorsten Leemhuis) - redhat/kernel.spec.template: enable cross for base/RT (Peter Robinson) - redhat/kernel.spec.template: Fix cross compiling (Peter Robinson) - arch/x86/kernel/setup.c: fixup rh_check_supported (Scott Weaver) - Enable CONFIG_USB_ONBOARD_HUB for RHEL (Charles Mirabile) - redhat/Makefile.cross: Add CROSS_BASEONLY (Prarit Bhargava) - gitlab-ci: fix ark-latest merging for parent pipelines running in forks (Michael Hofmann) - lsm: update security_lock_kernel_down (Scott Weaver) - Fix changelog after rebase (Augusto Caringi) - redhat: remove "END OF CHANGELOG" marker from kernel.changelog (Herton R. Krzesinski) - gitlab-ci: enable all variants for rawhide/eln builder image gating (Michael Hofmann) - Fedora: enable Microchip and their useful drivers (Peter Robinson) - spec: suppress "set +x" output (Jan Stancek) - redhat/configs: Disable CONFIG_RDMA_SIW (Kamal Heib) - redhat/configs: Disable CONFIG_RDMA_RXE (Kamal Heib) - redhat/configs: Disable CONFIG_MLX4 (Kamal Heib) - redhat/configs: Disable CONFIG_INFINIBAND_HFI1 and CONFIG_INFINIBAND_RDMAVT (Kamal Heib) - Consolidate 6.8 configs to common (Justin M. Forbes) - Remove rt-automated and master-rt-devel logic (Don Zickus) - Add support for CI octopus merging (Don Zickus) - redhat/configs: Disable CONFIG_INFINIBAND_VMWARE_PVRDMA (Kamal Heib) - gitlab-ci: fix merge tree URL for gating pipelines (Michael Hofmann) - Revert "net: bump CONFIG_MAX_SKB_FRAGS to 45" (Marcelo Ricardo Leitner) - uki: use systemd-pcrphase dracut module (Gerd Hoffmann) - Add libperf-debuginfo subpackage (Justin M. Forbes) - redhat/kernel.spec.template: Add log_msg macro (Prarit Bhargava) - redhat/configs: Disable CONFIG_INFINIBAND_USNIC (Kamal Heib) - Enable CONFIG_BMI323_I2C=m for Fedora x86_64 builds (Hans de Goede) - gitlab-ci: drop test_makefile job (Scott Weaver) - Enable merge-rt pipeline (Don Zickus) - kernel.spec: include the GDB plugin in kernel-debuginfo (Ondrej Mosnacek) - Turn on DRM_NOUVEAU_GSP_DEFAULT for Fedora (Justin M. Forbes) - Set late new config HDC3020 for Fedora (Justin M. Forbes) - redhat/self-test: Update CROSS_DISABLED_PACKAGES (Prarit Bhargava) - redhat: Do not build libperf with cross builds (Prarit Bhargava) - redhat/configs: enable CONFIG_PINCTRL_INTEL_PLATFORM for RHEL (David Arcari) - redhat/configs: enable CONFIG_PINCTRL_METEORPOINT for RHEL (David Arcari) - redhat/configs: intel pinctrl config cleanup (David Arcari) - redhat/configs: For aarch64/RT, default kstack randomization off (Jeremy Linton) - redhat/Makefile: remove an unused target (Ondrej Mosnacek) - redhat/Makefile: fix setup-source and document its caveat (Ondrej Mosnacek) - redhat/Makefile: fix race condition when making the KABI tarball (Ondrej Mosnacek) - redhat/Makefile: refactor KABI tarball creation (Ondrej Mosnacek) - Turn XFS_SUPPORT_V4 back on for Fedora (Justin M. Forbes) - Add xe to drm module filters (Justin M. Forbes) - Turn off the DRM_XE_KUNIT_TEST for Fedora (Justin M. Forbes) - Flip secureboot signature order (Justin M. Forbes) - all: clean up some removed configs (Peter Robinson) - redhat: add nvidia oot signing key (Dave Airlie) - gitlab-ci: support CI for zfcpdump kernel on ELN (Michael Hofmann) - Fedora configs for 6.8 (Justin M. Forbes) - Turn off CONFIG_INTEL_VSC for Fedora (Justin M. Forbes) - redhat/configs: rhel wireless requests (Jose Ignacio Tornos Martinez) - spec: Set EXTRA_CXXFLAGS for perf demangle-cxx.o (Josh Stone) [2233269] - Flip values for FSCACHE and NETFS_SUPPORT to avoid mismatch (Justin M. Forbes) - Turn on SECURITY_DMESG_RESTRICT (Justin M. Forbes) - redhat: forward-port genlog.py updates from c9s (Jan Stancek) - arch/x86: mark x86_64-v1 and x86_64-v2 processors as deprecated (Prarit Bhargava) - fedora: Enable more Renesas RZ platform drivers (Peter Robinson) - fedora: a few aarch64 drivers and cleanups (Peter Robinson) - fedora: cavium nitrox cnn55xx (Peter Robinson) - Fix dist-get-buildreqs breakage around perl(ExtUtils::Embed) (Don Zickus) - gitlab-ci: merge ark-latest fixes when running ELN pipelines (Michael Hofmann) - gitlab-ci: use all arches for container image gating (Michael Hofmann) - Add new os-build targets: rt-devel and automotive-devel (Don Zickus) - Remove defines forcing tools on, they override cmdline (Justin M. Forbes) - Remove separate license tag for libperf (Justin M. Forbes) - Don't use upstream bpftool version for Fedora package (Justin M. Forbes) - Don't ship libperf.a in libperf-devel (Justin M. Forbes) - add libperf packages and enable perf, libperf, tools and bpftool packages (Thorsten Leemhuis) - Add scaffolding to build the kernel-headers package for Fedora (Justin M. Forbes) - redhat/spec: use distro CFLAGS when building bootstrap bpftool (Artem Savkov) - spec: use just-built bpftool for vmlinux.h generation (Yauheni Kaliuta) [2120968] - gitlab-ci: enable native tools for Rawhide CI (Michael Hofmann) - Revert "Merge branch 'fix-kabi-build-race' into 'os-build'" (Justin M. Forbes) - redhat: configs: fedora: Enable sii902x bridge chip driver (Erico Nunes) - Enable CONFIG_TCP_CONG_ILLINOIS for RHEL (Davide Caratti) - redhat/Makefile: fix setup-source and document its caveat (Ondrej Mosnacek) - redhat/Makefile: fix race condition when making the KABI tarball (Ondrej Mosnacek) - redhat/Makefile: refactor KABI tarball creation (Ondrej Mosnacek) - redhat/configs: Remove HOTPLUG_CPU0 configs (Prarit Bhargava) - gitlab-ci: merge ark-latest before building in MR pipelines (Michael Hofmann) - CI: include aarch64 in CKI container image gating (Tales Aparecida) - redhat: spec: Fix update_scripts run for CentOS builds (Neal Gompa) - New configs in drivers/crypto (Fedora Kernel Team) - net: bump CONFIG_MAX_SKB_FRAGS to 45 (Marcelo Ricardo Leitner) - Enable CONFIG_MARVELL_88Q2XXX_PHY (Izabela Bakollari) - Remove CONFIG_NET_EMATCH_STACK file for RHEL (Justin M. Forbes) - CONFIG_NETFS_SUPPORT should be m after the merge (Justin M. Forbes) - Turn FSCACHE and NETFS from m to y in pending (Justin M. Forbes) - Turn on CONFIG_TCP_AO for Fedora (Justin M. Forbes) - Turn on IAA_CRYPTO_STATS for Fedora (Justin M. Forbes) - fedora: new drivers and cleanups (Peter Robinson) - Turn on Renesas RZ for Fedora IOT rhbz2257913 (Justin M. Forbes) - redhat: filter-modules.sh.rhel: add dell-smm-hwmon (Scott Weaver) - Add CONFIG_INTEL_MEI_GSC_PROXY=m for DRM 9.4 stable backport (Mika Penttilä) - Set configs for ZRAM_TRACK_ENTRY_ACTIME (Justin M. Forbes) - Add python3-pyyaml to buildreqs for kernel-docs (Justin M. Forbes) - Add nb7vpq904m to singlemods for ppc64le (Thorsten Leemhuis) - include drm bridge helpers in kernel-core package (Thorsten Leemhuis) - Add dell-smm-hwmon to singlemods (Thorsten Leemhuis) - Add drm_gem_shmem_test to mod-internal.list (Thorsten Leemhuis) - redhat: kABI: add missing RH_KABI_SIZE_ALIGN_CHECKS Kconfig option (Sabrina Dubroca) - redhat: rh_kabi: introduce RH_KABI_EXCLUDE_WITH_SIZE (Sabrina Dubroca) - redhat: rh_kabi: move semicolon inside __RH_KABI_CHECK_SIZE (Sabrina Dubroca) - Fix up ZRAM_TRACK_ENTRY_ACTIME in pending (Justin M. Forbes) - random: replace import_single_range() with import_ubuf() (Justin M. Forbes) - Flip CONFIG_INTEL_PMC_CORE to m for Fedora (Justin M. Forbes) - Add CONFIG_ZRAM_TRACK_ENTRY_ACTIME=y to avoid a mismatch (Justin M. Forbes) - common: cleanup MX3_IPU (Peter Robinson) - all: The Octeon MDIO driver is aarch64/mips (Peter Robinson) - common: rtc: remove bq4802 config (Peter Robinson) - common: de-dupe MARVELL_GTI_WDT (Peter Robinson) - all: Remove CAN_BXCAN (Peter Robinson) - common: cleanup SND_SOC_ROCKCHIP (Peter Robinson) - common: move RHEL DP83867_PHY to common (Peter Robinson) - common: Make ASYMMETRIC_KEY_TYPE enable explicit (Peter Robinson) - common: Disable aarch64 ARCH_MA35 universally (Peter Robinson) - common: arm64: enable Tegra234 pinctrl driver (Peter Robinson) - rhel: arm64: Enable qoriq thermal driver (Peter Robinson) - common: aarch64: Cleanup some i.MX8 config options (Peter Robinson) - all: EEPROM_LEGACY has been removed (Peter Robinson) - all: rmeove AppleTalk hardware configs (Peter Robinson) - all: cleanup: remove references to SLOB (Peter Robinson) - all: cleanup: Drop unnessary BRCMSTB configs (Peter Robinson) - all: net: remove retired network schedulers (Peter Robinson) - all: cleanup removed CONFIG_IMA_TRUSTED_KEYRING (Peter Robinson) - BuildRequires: lld for build with selftests for x86 (Jan Stancek) - spec: add keyutils to selftest-internal subpackage requirements (Artem Savkov) [2166911] - redhat/spec: exclude liburandom_read.so from requires (Artem Savkov) [2120968] - rtla: sync summary text with upstream and update Requires (Jan Stancek) - uki-virt: add systemd-sysext dracut module (Gerd Hoffmann) - uki-virt: add virtiofs dracut module (Gerd Hoffmann) - common: disable the FB device creation (Peter Robinson) - s390x: There's no FB on Z-series (Peter Robinson) - fedora: aarch64: enable SM_VIDEOCC_8350 (Peter Robinson) - fedora: arm64: enable ethernet on newer TI industrial (Peter Robinson) - fedora: arm64: Disable VIDEO_IMX_MEDIA (Peter Robinson) - fedora: use common config for Siemens Simatic IPC (Peter Robinson) - fedora: arm: enable Rockchip SPI flash (Peter Robinson) - fedora: arm64: enable DRM_TI_SN65DSI83 (Peter Robinson) - kernel.spec: remove kernel-smp reference from scripts (Jan Stancek) - redhat: do not compress the full kernel changelog in the src.rpm (Herton R. Krzesinski) - Auto consolidate configs for the 6.7 cycle (Justin M. Forbes) - Enable sound for a line of Huawei laptops (TomZanna) - fedora: a few cleanups and driver enablements (Peter Robinson) - fedora: arm64: cleanup Allwinner Pinctrl drivers (Peter Robinson) - fedora: aarch64: Enable some DW drivers (Peter Robinson) - redhat: ship all the changelog from source git into kernel-doc (Herton R. Krzesinski) - redhat: create an empty changelog file when changing its name (Herton R. Krzesinski) - redhat/self-test: Remove --all from git query (Prarit Bhargava) - Disable accel drivers for Fedora x86 (Kate Hsuan) - redhat: scripts: An automation script for disabling unused driver for x86 (Kate Hsuan) - Fix up Fedora LJCA configs and filters (Justin M. Forbes) - Fedora configs for 6.7 (Justin M. Forbes) - Some Fedora config updates for MLX5 (Justin M. Forbes) - Turn on DRM_ACCEL drivers for Fedora (Justin M. Forbes) - redhat: enable the kfence test (Nico Pache) - redhat/configs: Enable UCLAMP_TASK for PipeWire and WirePlumber (Neal Gompa) - Turn on CONFIG_SECURITY_DMESG_RESTRICT for Fedora (Justin M. Forbes) - Turn off shellcheck for the fedora-stable-release script (Justin M. Forbes) - Add some initial Fedora stable branch script to redhat/scripts/fedora/ (Justin M. Forbes) - redhat: disable iptables-legacy compatibility layer (Florian Westphal) - redhat: disable dccp conntrack support (Florian Westphal) - configs: enable netfilter_netlink_hook in fedora too (Florian Westphal) - ext4: Mark mounting fs-verity filesystems as tech-preview (Alexander Larsson) - erofs: Add tech preview markers at mount (Alexander Larsson) - Enable fs-verity (Alexander Larsson) - Enable erofs (Alexander Larsson) - aarch64: enable uki (Gerd Hoffmann) - redhat: enable CONFIG_SND_SOC_INTEL_SOF_DA7219_MACH as a module for x86 (Patrick Talbert) - Turn CONFIG_MFD_CS42L43_SDW on for RHEL (Justin M. Forbes) - Enable cryptographic acceleration config flags for PowerPC (Mamatha Inamdar) - Also make vmlinuz-virt.efi world readable (Zbigniew Jędrzejewski-Szmek) - Drop custom mode for System.map file (Zbigniew Jędrzejewski-Szmek) - Add drm_exec_test to mod-internal.list for depmod to succeed (Mika Penttilä) - RHEL 9.4 DRM backport (upto v6.6 kernel), sync Kconfigs (Mika Penttilä) - Turn on USB_DWC3 for Fedora (rhbz 2250955) (Justin M. Forbes) - redhat/configs: Move IOMMUFD to common (Alex Williamson) - redhat: Really remove cpupower files (Prarit Bhargava) - redhat: remove update_scripts.sh (Prarit Bhargava) - Fix s390 zfcpfdump bpf build failures for cgroups (Don Zickus) - Flip CONFIG_NVME_AUTH to m in pending (Justin M. Forbes) - Turn CONFIG_SND_SOC_INTEL_AVS_MACH_RT5514 on for Fedora x86 (Jason Montleon) - kernel/rh_messages.c: Mark functions as possibly unused (Prarit Bhargava) - Add snd-hda-cirrus-scodec-test to mod-internal.list (Scott Weaver) - Turn off BPF_SYSCALL in pending for zfcpdump (Justin M. Forbes) - Add mean_and_variance_test to mod-internal.list (Justin M. Forbes) - Add cfg80211-tests and mac80211-tests to mod-internal.list (Justin M. Forbes) - Turn on CONFIG_MFD_CS42L43_SDW for RHEL in pending (Justin M. Forbes) - Turn on bcachefs for Fedora (Justin M. Forbes) - redhat: configs: fedora: Enable QSEECOM and friends (Andrew Halaney) - Add clk-fractional-divider_test to mod-internal.list (Thorsten Leemhuis) - Add gso_test to mod-internal.list (Thorsten Leemhuis) - Add property-entry-test to mod-internal.list (Thorsten Leemhuis) - Fedora 6.7 configs part 1 (Justin M. Forbes) - [Scheduled job] Catch config mismatches early during upstream merge (Don Zickus) - redhat/self-test: Update data for KABI xz change (Prarit Bhargava) - redhat/scripts: Switch KABI tarballs to xz (Prarit Bhargava) - redhat/kernel.spec.template: Switch KABI compression to xz (Prarit Bhargava) - redhat: self-test: Use a more complete SRPM file suffix (Andrew Halaney) - redhat: makefile: remove stray rpmbuild --without (Eric Chanudet) - Consolidate configs into common for 6.6 (Justin M. Forbes) - Updated Fedora configs (Justin M. Forbes) - Turn on UFSHCD for Fedora x86 (Justin M. Forbes) - redhat: configs: generic: x86: Disable CONFIG_VIDEO_OV01A10 for x86 platform (Hans de Goede) - redhat: remove pending-rhel CONFIG_XFS_ASSERT_FATAL file (Patrick Talbert) - New configs in fs/xfs (Fedora Kernel Team) - crypto: rng - Override drivers/char/random in FIPS mode (Herbert Xu) - random: Add hook to override device reads and getrandom(2) (Herbert Xu) - redhat/configs: share CONFIG_ARM64_ERRATUM_2966298 between rhel and fedora (Mark Salter) - configs: Remove S390 IOMMU config options that no longer exist (Jerry Snitselaar) - redhat: docs: clarify where bugs and issues are created (Scott Weaver) - redhat/scripts/rh-dist-git.sh does not take any arguments: fix error message (Denys Vlasenko) - Add target_branch for gen_config_patches.sh (Don Zickus) - redhat: disable kunit by default (Nico Pache) - redhat/configs: enable the AMD_PMF driver for RHEL (David Arcari) - Make CONFIG_ADDRESS_MASKING consistent between fedora and rhel (Chris von Recklinghausen) - CI: add ark-latest baseline job to tag cki-gating for successful pipelines (Michael Hofmann) - CI: provide child pipelines for CKI container image gating (Michael Hofmann) - CI: allow to run as child pipeline (Michael Hofmann) - CI: provide descriptive pipeline name for scheduled pipelines (Michael Hofmann) - CI: use job templates for variant variables (Michael Hofmann) - redhat/kernel.spec.template: simplify __modsign_install_post (Jan Stancek) - Fedora filter updates after configs (Justin M. Forbes) - Fedora configs for 6.6 (Justin M. Forbes) - redhat/configs: Freescale Layerscape SoC family (Steve Best) - Add clang MR/baseline pipelines (Michael Hofmann) - CI: Remove unused kpet_tree_family (Nikolai Kondrashov) - Add clang config framework (Don Zickus) - Apply partial snippet configs to all configs (Don Zickus) - Remove unpackaged kgcov config files (Don Zickus) - redhat/configs: enable missing Kconfig options for Qualcomm RideSX4 (Brian Masney) - enable CONFIG_ADDRESS_MASKING for x86_64 (Chris von Recklinghausen) - common: aarch64: enable NXP Flex SPI (Peter Robinson) - fedora: Switch TI_SCI_CLK and TI_SCI_PM_DOMAINS symbols to built-in (Javier Martinez Canillas) - kernel.spec: adjust build option comment (Michael Hofmann) - kernel.spec: allow to enable arm64_16k variant (Michael Hofmann) - gitlab-ci: enable build-only pipelines for Rawhide/16k/aarch64 (Michael Hofmann) - kernel.spec.template: Fix --without bpftool (Prarit Bhargava) - redhat/configs: NXP BBNSM Power Key Driver (Steve Best) - redhat/self-test: Update data for cross compile fields (Prarit Bhargava) - redhat/Makefile.cross: Add message for disabled subpackages (Prarit Bhargava) - redhat/Makefile.cross: Update cross targets with disabled subpackages (Prarit Bhargava) - Remove XFS_ASSERT_FATAL from pending-fedora (Justin M. Forbes) - Change default pending for XFS_ONLINE_SCRUB_STATSas it now selects XFS_DEBUG (Justin M. Forbes) - gitlab-ci: use --with debug/base to select kernel variants (Michael Hofmann) - kernel.spec: add rpmbuild --without base option (Michael Hofmann) - redhat: spec: Fix typo for kernel_variant_preun for 16k-debug flavor (Neal Gompa) - Turn off appletalk for fedora (Justin M. Forbes) - New configs in drivers/media (Fedora Kernel Team) - redhat/docs: Add a mention of bugzilla for bugs (Prarit Bhargava) - Fix the fixup of Fedora release (Don Zickus) - Fix Fedora release scheduled job (Don Zickus) - Move squashfs to kernel-modules-core (Justin M. Forbes) - redhat: Explicitly disable CONFIG_COPS (Vitaly Kuznetsov) - redhat: Add dist-check-licenses target (Vitaly Kuznetsov) - redhat: Introduce "Verify SPDX-License-Identifier tags" selftest (Vitaly Kuznetsov) - redhat: Use kspdx-tool output for the License: field (Vitaly Kuznetsov) - Rename pipeline repo branch and DW tree names (Michael Hofmann) - Adjust comments that refer to ARK in a Rawhide context (Michael Hofmann) - Rename variable names starting with ark- to rawhide- (Michael Hofmann) - Rename trigger-ark to trigger-rawhide (Michael Hofmann) - Fix up config mismatches for Fedora (Justin M. Forbes) - redhat/configs: Texas Instruments Inc. K3 multicore SoC architecture (Steve Best) - Flip CONFIG_VIDEO_V4L2_SUBDEV_API in pending RHEL due to mismatch (Justin M. Forbes) - CONFIG_HW_RANDOM_HISI: move to common and set to m (Scott Weaver) - Turn off CONFIG_MEMORY_HOTPLUG_DEFAULT_ONLINE for Fedora s390x (Justin M. Forbes) - Disable tests for ELN realtime pipelines (Michael Hofmann) - New configs in mm/Kconfig (Fedora Kernel Team) - Flip CONFIG_SND_SOC_CS35L56_SDW to m and clean up (Justin M. Forbes) - Add drm_exec_test to mod-internal.list (Thorsten Leemhuis) - Add new pending entry for CONFIG_SND_SOC_CS35L56_SDW to fix mismatch (Justin M. Forbes) - Fix tarball creation logic (Don Zickus) - redhat: bump libcpupower soname to match upstream (Patrick Talbert) - Turn on MEMFD_CREATE in pending as it is selected by CONFIG_TMPFS (Justin M. Forbes) - redhat: drop unneeded build-time dependency gcc-plugin-devel (Coiby Xu) - all: x86: move wayward x86 specific config home (Peter Robinson) - all: de-dupe non standard config options (Peter Robinson) - all: x86: clean up microcode loading options (Peter Robinson) - common: remove unnessary CONFIG_SND_MESON_AXG* (Peter Robinson) - redhat: Fix UKI install with systemd >= 254 (Vitaly Kuznetsov) - redhat: Use named parameters for kernel_variant_posttrans()/kernel_variant_preun() (Vitaly Kuznetsov) - redhat/kernel.spec.template: update compression variables to support zstd (Brian Masney) - Consolidate configs to common for 6.5 (Justin M. Forbes) - Remove unused config entry for Fedora (Justin M. Forbes) - redhat/self-test: Remove rpmlint test (Prarit Bhargava) - Remove the armv7 config directory from Fedora again (Justin M. Forbes) - Enable CONFIG_EXPERT for both RHEL and Fedora (Justin M. Forbes) - redhat/configs: Enable CONFIG_DEVICE_PRIVATE on aarch64 (David Hildenbrand) [2231407] - redhat/configs: disable CONFIG_ROCKCHIP_ERRATUM_3588001 for RHEL (Mark Salter) - redhat: shellcheck fixes (Prarit Bhargava) - redhat/configs: enable tegra114 SPI (Mark Salter) - all: properly cleanup firewire once and for all (Peter Robinson) - Fix up filters for Fedora (Justin M. Forbes) - New configs in arch/x86 (Fedora Kernel Team) - Add an armv7 directory back for the Fedora configs (Justin M. Forbes) - Fedora 6.5 config updates (Justin M. Forbes) - Turn off DMABUF_SYSFS_STATS (Justin M. Forbes) - CI: rawhide_release: switch to using script to push (Don Zickus) - redhat/self-test: Update self-test data (Prarit Bhargava) - redhat/scripts/cross-compile: Update download_cross.sh (Prarit Bhargava) - redhat/Makefile.cross: Remove ARCH selection code (Prarit Bhargava) - redhat/Makefile.cross: Update script (Prarit Bhargava) - Fix interruptible non MR jobs (Michael Hofmann) - all: run evaluate_configs to de-dupe merged aarch64 (Peter Robinson) - all: arm: merge the arm and arm/aarch64 (Peter Robinson) - fedora: remove ARMv7 AKA armhfp configurations (Peter Robinson) - fedora: remove ARMv7 AKA armhfp support (Peter Robinson) - redhat/configs: enable CONFIG_VIRTIO_MEM on aarch64 (David Hildenbrand) [2044155] - redhat/configs: enable CONFIG_MEMORY_HOTREMOVE aarch64 (David Hildenbrand) [2062054] - redhat: Add arm64-16k kernel flavor scaffold for 16K page-size'd AArch64 (Neal Gompa) - fedora: enable i3c on aarch64 (Peter Robinson) - redhat/configs: Remove `CONFIG_HZ_1000 is not set` for aarch64 (Enric Balletbo i Serra) - redhat/configs: turn on the framework for SPI NOR for ARM (Steve Best) - configs: add new ChromeOS UART driver (Mark Langsdorf) - configs: add new ChromeOS Human Presence Sensor (Mark Langsdorf) - redhat/configs: Enable CONFIG_NVIDIA_WMI_EC_BACKLIGHT for both Fedora and RHEL (Kate Hsuan) - redhat/configs: Texas Instruments INA3221 driver (Steve Best) - arm: i.MX: Some minor NXP i.MX cleanups (Peter Robinson) - Description: Set config for Tegra234 pinctrl driver (Joel Slebodnick) - Update RPM Scriptlet for kernel-install Changes (Jonathan Steffan) - [CI] add exit 0 to the end of CI scripts (Don Zickus) - redhat: configs: Disable CONFIG_CRYPTO_STATS since performance issue for storage (Kate Hsuan) [2227793] - Remove obsolete variable from gitlab-ci.yml (Ondrej Kinst) - redhat/configs: Move GVT-g to Fedora only (Alex Williamson) - [CI] Make sure we are on correct branch before running script (Don Zickus) - CI: ark-update-configs: sync push command and output (Don Zickus) - CI: ark-update-configs: misc changes (Don Zickus) - CI: sync ark-create-release push commands with output (Don Zickus) - CI: ark-create-release: Add a robust check if nothing changed (Don Zickus) - CI: Remove legacy tag check cruft (Don Zickus) - CI: Introduce simple environment script (Don Zickus) - redhat/configs: Disable FIREWIRE for RHEL (Prarit Bhargava) - redhat/scripts/rh-dist-git.sh: print list of uploaded files (Denys Vlasenko) - redhat/scripts/expand_srpm.sh: add missing function, robustify (Denys Vlasenko) - redhat: Enable HSR and PRP (Felix Maurer) - redhat/scripts/rh-dist-git.sh: fix outdated message and comment (Denys Vlasenko) - redhat/configs: Disable CONFIG_I8K (Prarit Bhargava) - Make sure posttrans script doesn't fail if restorecon is not installed (Daan De Meyer) - Update filters for new config items (Justin M. Forbes) - More Fedora 6.5 configs (Justin M. Forbes) - redhat/configs: disable pre-UVC cameras for RHEL on aarch64 (Dean Nelson) - redhat/configs: enable CONFIG_MEDIA_SUPPORT for RHEL on aarch64 (Dean Nelson) - move ownership of /lib/modules// to kernel-core (Thorsten Leemhuis) - Let kernel-modules-core own the files depmod generates. (Thorsten Leemhuis) - redhat: configs: Enable CONFIG_TYPEC_STUSB160X for rhel on aarch64 (Desnes Nunes) - Add filters for ptp_dfl_tod on Fedora (Justin M. Forbes) - Fedora 6.5 configs part 1 (Justin M. Forbes) - fedora: enable CONFIG_ZYNQMP_IPI_MBOX as a builtin in pending-fedora (Patrick Talbert) - fedora: arm: some minor updates (Peter Robinson) - fedora: bluetooth: enable AOSP extensions (Peter Robinson) - fedora: wifi: tweak ZYDAS WiFI config options (Peter Robinson) - scsi: sd: Add "probe_type" module parameter to allow synchronous probing (Ewan D. Milne) [2140017] - redhat/configs: allow IMA to use MOK keys (Coiby Xu) - Simplify documentation jobs (Michael Hofmann) - Auto-cancel pipelines only on MRs (Michael Hofmann) - CI: Call script directly (Don Zickus) - CI: Remove stale TAG and Makefile cruft (Don Zickus) - CI: Move os-build tracking to common area (Don Zickus) - redhat: use the eln builder for daily jobs (Patrick Talbert) - redhat: set CONFIG_XILINX_WINDOW_WATCHDOG as disabled in pending (Patrick Talbert) - Add baseline ARK/ELN pipelines (Michael Hofmann) - Simplify job rules (Michael Hofmann) - Build ELN srpm for bot changes (Michael Hofmann) - Run RH selftests for ELN (Michael Hofmann) - Simplify job templates (Michael Hofmann) - Extract rules to allow orthogonal configuration (Michael Hofmann) - Require ELN pipelines if started automatically (Michael Hofmann) - Add ARK debug pipeline (Michael Hofmann) - Extract common parts of child pipeline job (Michael Hofmann) - Move ARK pipeline variables into job template (Michael Hofmann) - Simplify ARK pipeline rules (Michael Hofmann) - Change pathfix.py to %py3_shebang_fix (Justin M. Forbes) - Turn on NET_VENDOR_QUALCOMM for Fedora to enable rmnet (Justin M. Forbes) - redhat: add intel-m10-bmc-hwmon to filter-modules singlemods list (Patrick Talbert) - fedira: enable pending-fedora CONFIG_CPUFREQ_DT_PLATDEV as a module (Patrick Talbert) - redhat: fix the 'eln BUILD_TARGET' self-test (Patrick Talbert) - redhat: update the self-test-data (Patrick Talbert) - redhat: remove trailing space in dist-dump-variables output (Patrick Talbert) - Allow ELN pipelines failures (Michael Hofmann) - Enable cs-like CI (Michael Hofmann) - Allow to auto-cancel redundant pipelines (Michael Hofmann) - Remove obsolete unused trigger variable (Michael Hofmann) - Fix linter warnings in .gitlab-ci.yml (Michael Hofmann) - config: wifi: debug options for ath11k, brcm80211 and iwlwifi (Íñigo Huguet) - redhat: allow dbgonly cross builds (Jan Stancek) - redhat/configs: Clean up x86-64 call depth tracking configs (Waiman Long) - redhat: move SND configs from pending-rhel to rhel (Patrick Talbert) - Fix up armv7 configs for Fedora (Justin M. Forbes) - redhat: Set pending-rhel x86 values for various SND configs (Patrick Talbert) - redhat: update self-test data (Patrick Talbert) - redhat: ignore SPECBPFTOOLVERSION/bpftoolversion in self-test create-data.sh (Patrick Talbert) - fedora/rhel: Move I2C_DESIGNWARE_PLATFORM, I2C_SLAVE, & GPIOLIB from pending (Patrick Talbert) - redhat/filter-modules.sh.rhel: add needed deps for intel_rapl_tpmi (Jan Stancek) - fedora: Enable CONFIG_SPI_SLAVE (Patrick Talbert) - fedora/rhel: enable I2C_DESIGNWARE_PLATFORM, I2C_SLAVE, and GPIOLIB (Patrick Talbert) - fedora: Enable CONFIG_SPI_SLAVE in fedora-pending (Patrick Talbert) - redhat: remove extra + (plus) from meta package Requires definitions (Patrick Talbert) - Add intel-m10-bmc-hwmon to singlemods (Thorsten Leemhuis) - Add hid-uclogic-test to mod-internal.list (Thorsten Leemhuis) - Add checksum_kunit.ko to mod-internal.list (Thorsten Leemhuis) - Add strcat_kunit to mod-internal.list (Thorsten Leemhuis) - Add input_test to mod-intenal.list (Thorsten Leemhuis) - Revert "Remove EXPERT from ARCH_FORCE_MAX_ORDER for aarch64" (Justin M. Forbes) - Fix up rebase issue with CONFIG_ARCH_FORCE_MAX_ORDER (Justin M. Forbes) - redhat/kernel.spec.template: Disable 'extracting debug info' messages (Prarit Bhargava) - kernel/rh_messages.c: Another gcc12 warning on redundant NULL test (Florian Weimer) [2216678] - redhat: fix signing for realtime and arm64_64k non-debug variants (Jan Stancek) - redhat: treat with_up consistently (Jan Stancek) - redhat: make with_realtime opt-in (Jan Stancek) - redhat/configs: Disable qcom armv7 drippings in the aarch64 tree (Jeremy Linton) - kernel.spec: drop obsolete ldconfig (Jan Stancek) - Consolidate config items to common for 6.4 cycle (Justin M. Forbes) - Turn on CO?NFIg_RMNET for Fedora (Justin M. Forbes) - redhat/configs: enable CONFIG_MANA_INFINIBAND=m for ARK (Vitaly Kuznetsov) - redhat/config: common: Enable CONFIG_GPIO_SIM for software development (Kate Hsuan) - redhat: fix problem with RT kvm modules listed twice in rpm generation (Clark Williams) - redhat: turn off 64k kernel builds with rtonly (Clark Williams) - redhat: turn off zfcpdump for rtonly (Clark Williams) - redhat: don't allow with_rtonly to turn on unsupported arches (Clark Williams) - redhat: update self-test data for addition of RT and 64k-page variants (Clark Williams) - redhat: fix realtime and efiuki build conflict (Jan Stancek) - arm64-64k: Add new kernel variant to RHEL9/CS9 for 64K page-size'd ARM64 (Donald Dutile) [2153073] - redhat: TEMPORARY set configs to deal with PREEMPT_RT not available (Clark Williams) - redhat: TEMPORARY default realtime to off (Clark Williams) - redhat: moved ARM errata configs to arm dir (Clark Williams) - redhat: RT packaging changes (Clark Williams) - redhat: miscellaneous commits needed due to CONFIG_EXPERT (Clark Williams) - redhat: realtime config entries (Clark Williams) - common: remove deleted USB PCCARD drivers (Peter Robinson) - fedora: further cleanup of pccard/cardbus subsystem (Peter Robinson) - common: properly disable PCCARD subsystem (Peter Robinson) - redhat/configs: arm: enable SERIAL_TEGRA UART for RHEL (Mark Salter) - redhat/configs: enable CONFIG_X86_AMD_PSTATE_UT (David Arcari) - redhat/configs: Enable CONFIG_TCG_VTPM_PROXY for RHEL (Štěpán Horáček) - redhat: do not package *.mod.c generated files (Denys Vlasenko) - ALSA configuration changes for ARK/RHEL 9.3 (Jaroslav Kysela) - spec: remove resolve_btfids from kernel-devel (Viktor Malik) - Fix typo in filter-modules (Justin M. Forbes) - redhat/configs: Enable CONFIG_INIT_STACK_ALL_ZERO for RHEL (Josh Poimboeuf) - Remove CONFIG_ARCH_FORCE_MAX_ORDER for aarch64 (Justin M. Forbes) - Fix up config and filter for PTP_DFL_TOD (Justin M. Forbes) - redhat/configs: IMX8ULP pinctrl driver (Steve Best) - redhat/configs: increase CONFIG_FRAME_WARN for Fedora on aarch64 (Brian Masney) - redhat/configs: add two missing Kconfig options for the Thinkpad x13s (Brian Masney) - Fedora configs for 6.4 (Justin M. Forbes) - Change aarch64 CONFIG_ARCH_FORCE_MAX_ORDER to 10 for 4K pages (Justin M. Forbes) - kernel.spec: remove "RPM_VMLINUX_H=$DevelDir/vmlinux.h" code chunk in %install (Denys Vlasenko) - redhat/configs: aarch64: Turn on Display for OnePlus 6 (Eric Curtin) - redhat/configs: NXP i.MX93 pinctrl, clk, analog to digital converters (Steve Best) - redhat/configs: Enable CONFIG_SC_GPUCC_8280XP for fedora (Andrew Halaney) - redhat/configs: Enable CONFIG_QCOM_IPCC for fedora (Andrew Halaney) - Add rv subpackage for kernel-tools (John Kacur) [2188441] - redhat/configs: NXP i.MX9 family (Steve Best) - redhat/genlog.py: add support to list/process zstream Jira tickets (Herton R. Krzesinski) - redhat: fix duplicate jira issues in the resolves line (Herton R. Krzesinski) - redhat: add support for Jira issues in changelog (Herton R. Krzesinski) - redhat/configs: turn on IMX8ULP CCM Clock Driver (Steve Best) - redhat: update filter-modules fsdrvs list to reference smb instead of cifs (Patrick Talbert) - Turn off some debug options found to impact performance (Justin M. Forbes) - wifi: rtw89: enable RTL8852BE card in RHEL (Íñigo Huguet) - redhat/configs: enable TEGRA186_GPC_DMA for RHEL (Mark Salter) - Move imx8m configs from fedora to common (Mark Salter) - redhat/configs: turn on lpuart serial port support Driver (Steve Best) [2208834] - Turn off DEBUG_VM for non debug Fedora kernels (Justin M. Forbes) - Enable CONFIG_BT on aarch64 (Charles Mirabile) - redhat/configs: turn on CONFIG_MARVELL_CN10K_TAD_PMU (Michal Schmidt) [2042240] - redhat/configs: Fix enabling MANA Infiniband (Kamal Heib) - Fix file listing for symvers in uki (Justin M. Forbes) - Fix up some Fedora config items (Justin M. Forbes) - enable efifb for Nvidia (Justin M. Forbes) - kernel.spec: package unstripped test_progs-no_alu32 (Felix Maurer) - Turn on NFT_CONNLIMIT for Fedora (Justin M. Forbes) - Include the information about builtin symbols into kernel-uki-virt package too (Vitaly Kuznetsov) - redhat/configs: Fix incorrect configs location and content (Vladis Dronov) - redhat/configs: turn on CONFIG_MARVELL_CN10K_DDR_PMU (Michal Schmidt) [2042241] - redhat: configs: generic: x86: Disable CONFIG_VIDEO_OV2740 for x86 platform (Kate Hsuan) - Enable IO_URING for RHEL (Justin M. Forbes) - Turn on IO_URING for RHEL in pending (Justin M. Forbes) - redhat: Remove editconfig (Prarit Bhargava) - redhat: configs: fix CONFIG_WERROR replace in build_configs (Jan Stancek) - redhat/configs: enable Maxim MAX77620 PMIC for RHEL (Mark Salter) - kernel.spec: skip kernel meta package when building without up (Jan Stancek) - redhat/configs: enable RDMA_RXE for RHEL (Kamal Heib) [2022578] - redhat/configs: update RPCSEC_GSS_KRB5 configs (Scott Mayhew) - redhat/Makefile: Support building linux-next (Thorsten Leemhuis) - redhat/Makefile: support building stable-rc versions (Thorsten Leemhuis) - redhat/Makefile: Add target to print DISTRELEASETAG (Thorsten Leemhuis) - Remove EXPERT from ARCH_FORCE_MAX_ORDER for aarch64 (Justin M. Forbes) - Revert "Merge branch 'unstripped-no_alu32' into 'os-build'" (Patrick Talbert) - configs: Enable CONFIG_PAGE_POOL_STATS for common/generic (Patrick Talbert) - redhat/configs: enable CONFIG_DELL_WMI_PRIVACY for both RHEL and Fedora (David Arcari) - kernel.spec: package unstripped test_progs-no_alu32 (Felix Maurer) - bpf/selftests: fix bpf selftests install (Jerome Marchand) - kernel.spec: add bonding selftest (Hangbin Liu) - Change FORCE_MAX_ORDER for ppc64 to be 8 (Justin M. Forbes) - kernel.spec.template: Add global compression variables (Prarit Bhargava) - kernel.spec.template: Use xz for KABI (Prarit Bhargava) - kernel.spec.template: Remove gzip related aarch64 code (Prarit Bhargava) - Add apple_bl to filter-modules (Justin M. Forbes) - Add handshake-test to mod-intenal.list (Justin M. Forbes) - Add regmap-kunit to mod-internal.list (Justin M. Forbes) - configs: set CONFIG_PAGE_POOL_STATS (Patrick Talbert) - Add apple_bl to fedora module_filter (Justin M. Forbes) - Fix up some config mismatches in new Fedora config items (Justin M. Forbes) - redhat/configs: disable CONFIG_USB_NET_SR9700 for aarch64 (Jose Ignacio Tornos Martinez) - Fix up the RHEL configs for xtables and ipset (Justin M. Forbes) - ark: enable wifi on aarch64 (Íñigo Huguet) - fedora: wifi: hermes: disable 802.11b driver (Peter Robinson) - fedora: wifi: libertas: use the LIBERTAS_THINFIRM driver (Peter Robinson) - fedora: wifi: disable Zydas vendor (Peter Robinson) - redhat: fix python ValueError in error path of merge.py (Clark Williams) - fedora: arm: minor updates (Peter Robinson) - kernel.spec: Fix UKI naming to comply with BLS (Philipp Rudo) - redhat/kernel.spec.template: Suppress 'extracting debug info' noise in build log (Prarit Bhargava) - Fedora 6.3 configs part 2 (Justin M. Forbes) - redhat/configs: Enable CONFIG_X86_KERNEL_IBT for Fedora and ARK (Josh Poimboeuf) - kernel.spec: gcov: make gcov subpackages per variant (Jan Stancek) - kernel.spec: Gemini: add Epoch to perf and rtla subpackages (Jan Stancek) - kernel.spec: Gemini: fix header provides for upgrade path (Jan Stancek) - redhat: introduce Gemini versioning (Jan Stancek) - redhat: separate RPM version from uname version (Jan Stancek) - redhat: introduce GEMINI and RHEL_REBASE_NUM variable (Jan Stancek) - ipmi: ssif_bmc: Add SSIF BMC driver (Tony Camuso) - common: minor de-dupe of parallel port configs (Peter Robinson) - Fedora 6.3 configs part 1 (Justin M. Forbes) - redhat: configs: Enable CONFIG_MEMTEST to enable memory test (Kate Hsuan) - Update Fedora arm filters after config updates (Nicolas Chauvet) - redhat/kernel.spec.template: Fix kernel-tools-libs-devel dependency (Prarit Bhargava) - redhat: fix the check for the n option (Patrick Talbert) - common: de-dupe some options that are the same (Peter Robinson) - generic: remove deleted options (Peter Robinson) - redhat/configs: enable CONFIG_INTEL_TCC_COOLING for RHEL (David Arcari) - Update Fedora ppc filters after config updates (Justin M. Forbes) - Update Fedora aarch64 filters after config updates (Justin M. Forbes) - fedora: arm: Updates for 6.3 (Peter Robinson) - redhat: kunit: cleanup NITRO config and enable rescale test (Nico Pache) - kernel.spec: use %{package_name} to fix kernel-devel-matched Requires (Jan Stancek) - kernel.spec: use %{package_name} also for abi-stablelist subpackages (Jan Stancek) - kernel.spec: use %{package_name} also for tools subpackages (Jan Stancek) - generic: common: Parport and paride/ata cleanups (Peter Robinson) - CONFIG_SND_SOC_CS42L83 is no longer common (Justin M. Forbes) - configs: arm: bring some configs in line with rhel configs in c9s (Mark Salter) - arm64/configs: Put some arm64 configs in the right place (Mark Salter) - cleanup removed R8188EU config (Peter Robinson) - Make RHJOBS container friendly (Don Zickus) - Remove scmversion from kernel.spec.template (Don Zickus) - redhat/configs: Enable CONFIG_SND_SOC_CS42L83 (Neal Gompa) - Use RHJOBS for create-tarball (Don Zickus) - Enable CONFIG_NET_SCH_FQ_PIE for Fedora (Justin M. Forbes) - Make Fedora debug configs more useful for debug (Justin M. Forbes) - redhat/configs: enable Octeon TX2 network drivers for RHEL (Michal Schmidt) [2040643] - redhat/kernel.spec.template: fix installonlypkg for meta package (Jan Stancek) - redhat: version two of Makefile.rhelver tweaks (Clark Williams) - redhat/configs: Disable CONFIG_GCC_PLUGINS (Prarit Bhargava) - redhat/kernel.spec.template: Fix typo for process_configs.sh call (Neal Gompa) - redhat/configs: CONFIG_CRYPTO_SM3_AVX_X86_64 is x86 only (Vladis Dronov) - redhat/configs: Enable CONFIG_PINCTRL_METEORLAKE in RHEL (Prarit Bhargava) - fedora: enable new image sensors (Peter Robinson) - redhat/self-test: Update self-test data (Prarit Bhargava) - redhat/kernel.spec.template: Fix hardcoded "kernel" (Prarit Bhargava) - redhat/configs/generate_all_configs.sh: Fix config naming (Prarit Bhargava) - redhat/kernel.spec.template: Pass SPECPACKAGE_NAME to generate_all_configs.sh (Prarit Bhargava) - kernel.spec.template: Use SPECPACKAGE_NAME (Prarit Bhargava) - redhat/Makefile: Copy spec file (Prarit Bhargava) - redhat: Change PACKAGE_NAME to SPECPACKAGE_NAME (Prarit Bhargava) - redhat/configs: Support the virtio_mmio.device parameter in Fedora (David Michael) - Revert "Merge branch 'systemd-boot-unsigned' into 'os-build'" (Patrick Talbert) - redhat/Makefile: fix default values for dist-brew's DISTRO and DIST (Íñigo Huguet) - Remove cc lines from automatic configs (Don Zickus) - Add rtla-hwnoise files (Justin M. Forbes) - redhat/kernel.spec.template: Mark it as a non-executable file (Neal Gompa) - fedora: arm: Enable DRM_PANEL_HIMAX_HX8394 (Javier Martinez Canillas) - redhat/configs: CONFIG_HP_ILO location fix (Vladis Dronov) - redhat: Fix build for kselftests mm (Nico Pache) - fix tools build after vm to mm rename (Justin M. Forbes) - redhat/spec: Update bpftool versioning scheme (Viktor Malik) - redhat/configs: CONFIG_CRYPTO_SM4_AESNI_AVX*_X86_64 is x86 only (Prarit Bhargava) - redhat: adapt to upstream Makefile change (Clark Williams) - redhat: modify efiuki specfile changes to use variants convention (Clark Williams) - Turn off DEBUG_INFO_COMPRESSED_ZLIB for Fedora (Justin M. Forbes) - redhat/kernel.spec.template: Fix RHEL systemd-boot-unsigned dependency (Prarit Bhargava) - Add hashtable_test to mod-internal.list (Justin M. Forbes) - Add more kunit tests to mod-internal.list for 6.3 (Justin M. Forbes) - Flip CONFIG_I2C_ALGOBIT to m (Justin M. Forbes) - Flip I2C_ALGOBIT to m to avoid mismatch (Justin M. Forbes) - kernel.spec: move modules.builtin to kernel-core (Jan Stancek) - Turn on IDLE_INJECT for x86 (Justin M. Forbes) - Flip CONFIG_IDLE_INJECT in pending (Justin M. Forbes) - redhat/configs: Enable CONFIG_V4L_TEST_DRIVERS related drivers (Enric Balletbo i Serra) - redhat/configs: Enable UCSI_CCG support (David Marlin) - Fix underline mark-up after text change (Justin M. Forbes) - Turn on CONFIG_XFS_RT for Fedora (Justin M. Forbes) - Consolidate common configs for 6.2 (Justin M. Forbes) - aarch64: enable zboot (Gerd Hoffmann) - redhat: remove duplicate pending-rhel config items (Patrick Talbert) - Disable frame pointers (Justin M. Forbes) - redhat/configs: update scripts and docs for ark -> rhel rename (Clark Williams) - redhat/configs: rename ark configs dir to rhel (Clark Williams) - Turn off CONFIG_DEBUG_INFO_COMPRESSED_ZLIB for ppc64le (Justin M. Forbes) - kernel.spec: package unstripped kselftests/bpf/test_progs (Jan Stancek) - kernel.spec: allow to package some binaries as unstripped (Jan Stancek) - redhat/configs: Make merge.py portable for older python (Desnes Nunes) - Fedora configs for 6.2 (Justin M. Forbes) - redhat: Repair ELN build broken by the recent UKI changes (Vitaly Kuznetsov) - redhat/configs: enable CONFIG_INET_DIAG_DESTROY (Andrea Claudi) - Enable TDX Guest driver (Vitaly Kuznetsov) - redhat/configs: Enable CONFIG_PCIE_PTM generically (Corinna Vinschen) - redhat: Add sub-RPM with a EFI unified kernel image for virtual machines (Vitaly Kuznetsov) - redhat/Makefile: Remove GIT deprecated message (Prarit Bhargava) - Revert "redhat: configs: Disable xtables and ipset" (Phil Sutter) - redhat/configs: Enable CONFIG_SENSORS_LM90 for RHEL (Mark Salter) - Fix up SQUASHFS decompression configs (Justin M. Forbes) - redhat/configs: enable CONFIG_OCTEON_EP as a module in ARK (Michal Schmidt) [2041990] - redhat: ignore rpminspect runpath report on urandom_read selftest binaries (Herton R. Krzesinski) - kernel.spec: add llvm-devel build requirement (Scott Weaver) - Update self-test data to not expect debugbuildsenabled 0 (Justin M. Forbes) - Turn off forced debug builds (Justin M. Forbes) - Turn on debug builds for aarch64 Fedora (Justin M. Forbes) - redhat/configs: modify merge.py to match old overrides input (Clark Williams) - redhat: fixup pylint complaints (Clark Williams) - redhat: remove merge.pl and references to it (Clark Williams) - redhat: update merge.py to handle merge.pl corner cases (Clark Williams) - Revert "redhat: fix elf got hardening for vm tools" (Don Zickus) - Update rebase notes for Fedora (Justin M. Forbes) - Update CONFIG_LOCKDEP_CHAINS_BITS to 19 (cmurf) - redhat/configs: Turn on CONFIG_SPI_TEGRA210_QUAD for RHEL (Mark Salter) - ark: aarch64: drop CONFIG_SMC911X (Peter Robinson) - all: cleanup and de-dupe CDROM_PKTCDVD options. (Peter Robinson) - all: remove CRYPTO_GF128MUL (Peter Robinson) - all: cleanup UEFI options (Peter Robinson) - common: arm64: Enable Ampere Altra SMpro Hardware Monitoring (Peter Robinson) - fedora: enable STACKPROTECTOR_STRONG (Peter Robinson) - fedora: enable STACKPROTECTOR on arm platforms (Peter Robinson) - redhat/self-test: Update data with ENABLE_WERROR (Prarit Bhargava) - redhat/Makefile.variables: Add ENABLE_WERROR (Prarit Bhargava) - makefile: Add -Werror support for RHEL (Prarit Bhargava) - redhat/Makefile.variables: Remove mention of Makefile.rhpkg (Prarit Bhargava) - redhat/Makefile.variables: Alphabetize variables (Prarit Bhargava) - gitlab-ci: use CI templates from production branch (Michael Hofmann) - redhat/kernel.spec.template: Fix internal "File listed twice" errors (Prarit Bhargava) - redhat: Remove stale .tmp_versions code and comments (Prarit Bhargava) - redhat/kernel.spec.template: Fix vmlinux_decompressor on !s390x (Prarit Bhargava) - redhat/kernel.spec.template: Remove unnecessary output from pathfix.py (Prarit Bhargava) - Modularize CONFIG_ARM_CORESIGHT_PMU_ARCH_SYSTEM_PMU (Mark Salter) - redhat/kernel.spec.template: Parallelize compression (Prarit Bhargava) - config: Enable Security Path (Ricardo Robaina) - redhat/self-test/data: Regenerate self-test data for make change (Prarit Bhargava) - Update module filters for nvmem_u-boot-env (Justin M. Forbes) - fedora: Updates for 6.2 merge (Peter Robinson) - fedora: Updates for 6.1 merge (Peter Robinson) - modules-core: use %posttrans (Gerd Hoffmann) - split sub-rpm kernel-modules-core from kernel-core (Gerd Hoffmann) - Turn off CONFIG_MTK_T7XX for S390x (Justin M. Forbes) - CI: add variable for variant handling (Veronika Kabatova) - Fix up configs with SND_SOC_NAU8315 mismatch (Justin M. Forbes) - CI: Do a full build for non-bot runs (Veronika Kabatova) - Fix up configs with SND_SOC_NAU8315 mismatch (Justin M. Forbes) - kernel/rh_messages.c: gcc12 warning on redundant NULL test (Eric Chanudet) [2142658] - redhat/configs: Enable CRYPTO_CURVE25519 in ark (Prarit Bhargava) - general: arm: cleanup ASPEED options (Peter Robinson) - redhat/configs: ALSA - cleanups for the AMD Pink Sardine DMIC driver (Jaroslav Kysela) - redhat/docs: Add FAQ entry for booting between Fedora & ELN/RHEL kernels (Prarit Bhargava) - spec: add missing BuildRequires: python3-docutils for tools (Ondrej Mosnacek) - config: enable RCU_TRACE for debug kernels (Wander Lairson Costa) - Add siphash_kunit and strscpy_kunit to mod-internal.list (Justin M. Forbes) - Add drm_kunit_helpers to mod-internal.list (Justin M. Forbes) - Fix up configs for Fedora so we don't have a mismatch (Justin M. Forbes) - Turn on CONFIG_SQUASHFS_DECOMP_SINGLE in pending (Justin M. Forbes) - redhat/kernel.spec.template: Fix cpupower file error (Prarit Bhargava) - redhat/configs: aarhc64: clean up some erratum configs (Mark Salter) - More Fedora configs for 6.1 as deps were switched on (Justin M. Forbes) - redhat/configs: make SOC_TEGRA_CBB a module (Mark Salter) - redhat/configs: aarch64: reorganize tegra configs to common dir (Mark Salter) - Enforces buildroot if cross_arm (Nicolas Chauvet) - Handle automated case when config generation works correctly (Don Zickus) - Turn off CONFIG_CRYPTO_ARIA_AESNI_AVX_X86_64 (Justin M. Forbes) - Turn off CONFIG_EFI_ZBOOT as it makes CKI choke (Justin M. Forbes) - Fedora config updates for 6.1 (Justin M. Forbes) - redhat: Remove cpupower files (Prarit Bhargava) - redhat/configs: update CXL-related options to match what RHEL will use (John W. Linville) - Clean up the config for the Tegra186 timer (Al Stone) - redhat/configs: move CONFIG_TEGRA186_GPC_DMA config (Mark Salter) - Check for kernel config git-push failures (Don Zickus) - redhat: genlog.sh failures should interrupt the recipe (Patrick Talbert) - Turn CONFIG_GNSS back on for Fedora (Justin M. Forbes) - redhat/configs: enable CONFIG_GNSS for RHEL (Michal Schmidt) - Turn off NVMEM_U_BOOT_ENV for fedora (Justin M. Forbes) - Consolidate matching fedora and ark entries to common (Justin M. Forbes) - Empty out redhat/configs/common (Justin M. Forbes) - Adjust path to compressed vmlinux kernel image for s390x (Justin M. Forbes) [2149273] - Fedora config updates for 6.1 (Justin M. Forbes) - redhat: genlog.sh should expect genlog.py in the current directory (Patrick Talbert) - redhat/configs: consolidate CONFIG_TEST_LIVEPATCH=m (Joe Lawrence) - redhat/configs: enable CONFIG_TEST_LIVEPATCH=m for s390x (Julia Denham) - Revert "Merge branch 'ark-make-help' into 'os-build'" (Scott Weaver) - Remove recommendation to use 'common' for config changes. (Don Zickus) - Update config to add i3c support for AArch64 (Mark Charlebois) - redhat: Move cross-compile scripts into their own directory (Prarit Bhargava) - redhat: Move yaml files into their own directory (Prarit Bhargava) - redhat: Move update_scripts.sh into redhat/scripts (Prarit Bhargava) - redhat: Move kernel-tools scripts into their own directory (Prarit Bhargava) - redhat: Move gen-* scripts into their own directory (Prarit Bhargava) - redhat: Move mod-* scripts into their own directory (Prarit Bhargava) - redhat/Makefile: Fix RHJOBS grep warning (Prarit Bhargava) - redhat: Force remove tmp file (Prarit Bhargava) - redhat/configs: ALSA - cleanups for the CentOS 9.2 update (Jaroslav Kysela) - CI: Use CKI container images from quay.io (Veronika Kabatova) - redhat: clean up the partial-kgcov-snip.config file (Patrick Talbert) - redhat: avoid picking up stray editor backups when processing configs (Clark Williams) - CI: Remove old configs (Veronika Kabatova) - redhat: override `make help` to include dist-help (Jonathan Toppins) - redhat: make RHTEST stricter (Jonathan Toppins) - redhat: Enable support for SN2201 system (Ivan Vecera) - redhat/docs/index.rst: Add FLAVOR information to generate configs for local builds (Enric Balletbo i Serra) - redhat: fix selftest git command so it picks the right commit (Patrick Talbert) - redhat/configs: enable HP_WATCHDOG for aarch64 (Mark Salter) - redhat: disable Kfence Kunit Test (Nico Pache) - configs: enable CONFIG_LRU_GEN_ENABLED everywhere (Patrick Talbert) - redhat: Enable WWAN feature and support for Intel, Qualcomm and Mediatek devices (Jose Ignacio Tornos Martinez) - Turn on dln2 support (RHBZ 2110372) (Justin M. Forbes) - Enable configs for imx8m PHYs (Al Stone) - configs/fedora: Build some SC7180 clock controllers as modules (Javier Martinez Canillas) - redhat/configs: Disable fbdev drivers and use simpledrm everywhere (Javier Martinez Canillas) [1986223] - redhat: fix the branch we pull from the documentation tree (Herton R. Krzesinski) - redhat/configs: change so watchdog is module versus builtin (Steve Best) - redhat/configs: move CONFIG_ACPI_VIDEO to common/generic (Mark Langsdorf) - enable imx8xm I2C configs properly (Al Stone) - configs/fedora: Enable a few more drivers needed by the HP X2 Chromebook (Javier Martinez Canillas) - enable the rtc-rv8803 driver on RHEL and Fedora (David Arcari) - redhat/Makefile: Remove BUILD_SCRATCH_TARGET (Prarit Bhargava) - configs: move CONFIG_INTEL_TDX_GUEST to common directory (Wander Lairson Costa) - redhat/Makefile: Use new BUILD_TARGET for RHEL dist[g]-brew target (Prarit Bhargava) - redhat: method.py: change the output loop to use 'values' method (Patrick Talbert) - redhat: use 'update' method in merge.py (Patrick Talbert) - redhat: Use a context manager in merge.py for opening the config file for reading (Patrick Talbert) - redhat: automatically strip newlines in merge.py (Clark Williams) - redhat: python replacement for merge.pl (Clark Williams) - redhat/docs: Update with DISTLOCALVERSION (Prarit Bhargava) - redhat/Makefile: Rename LOCALVERSION to DISTLOCALVERSION (Akihiko Odaki) - Adjust FIPS module name in RHEL (Vladis Dronov) - spec: prevent git apply from searching for the .git directory (Ondrej Mosnacek) - redhat: Remove parallel_xz.sh (Prarit Bhargava) - Turn on Multi-Gen LRU for Fedora (Justin M. Forbes) - Add kasan_test to mod-internal.list (Justin M. Forbes) - redhat/Makefile.variables: Fix typo with RHDISTGIT_TMP (Prarit Bhargava) - spec: fix path to `installing_core` stamp file for subpackages (Jonathan Lebon) - Remove unused ci scripts (Don Zickus) - Rename rename FORCE_MAX_ZONEORDER to ARCH_FORCE_MAX_ORDER in configs (Justin M. Forbes) - redhat: Add new fortify_kunit & is_signed_type_kunit to mod-internal.list (Patrick Talbert) - Rename rename FORCE_MAX_ZONEORDER to ARCH_FORCE_MAX_ORDER in pending (Justin M. Forbes) - Add acpi video to the filter_modules.sh for rhel (Justin M. Forbes) - Change acpi_bus_get_acpi_device to acpi_get_acpi_dev (Justin M. Forbes) - Turn on ACPI_VIDEO for arm (Justin M. Forbes) - Turn on CONFIG_PRIME_NUMBERS as a module (Justin M. Forbes) - Add new drm kunit tests to mod-internal.list (Justin M. Forbes) - redhat: fix elf got hardening for vm tools (Frantisek Hrbata) - kernel.spec.template: remove some temporary files early (Ondrej Mosnacek) - kernel.spec.template: avoid keeping two copies of vmlinux (Ondrej Mosnacek) - Add fortify_kunit to mod-internal.list (Justin M. Forbes) - Add module filters for Fedora as acpi video has new deps (Justin M. Forbes) - One more mismatch (Justin M. Forbes) - Fix up pending for mismatches (Justin M. Forbes) - Forgot too remove this from pending, it is set properly in ark (Justin M. Forbes) - redhat/Makefile: Add DIST to git tags for RHEL (Prarit Bhargava) - redhat/configs: Move CONFIG_ARM_SMMU_QCOM_DEBUG to common (Jerry Snitselaar) - Common config cleanup for 6.0 (Justin M. Forbes) - Allow selftests to fail without killing the build (Justin M. Forbes) - redhat: Remove redhat/Makefile.rhpkg (Prarit Bhargava) - redhat/Makefile: Move RHDISTGIT_CACHE and RHDISTGIT_TMP (Prarit Bhargava) - redhat/Makefile.rhpkg: Remove RHDISTGIT_USER (Prarit Bhargava) - redhat/Makefile: Move RHPKG_BIN to redhat/Makefile (Prarit Bhargava) - common: clean up Android option with removal of CONFIG_ANDROID (Peter Robinson) - redhat/configs: Remove x86_64 from priority files (Prarit Bhargava) - redhat/configs/pending-ark: Remove x86_64 directory (Prarit Bhargava) - redhat/configs/pending-fedora: Remove x86_64 directory (Prarit Bhargava) - redhat/configs/fedora: Remove x86_64 directory (Prarit Bhargava) - redhat/configs/common: Remove x86_64 directory (Prarit Bhargava) - redhat/configs/ark: Remove x86_64 directory (Prarit Bhargava) - redhat/configs/custom-overrides: Remove x86_64 directory (Prarit Bhargava) - configs: use common CONFIG_ARM64_SME for ark and fedora (Mark Salter) - redhat/configs: Add a warning message to priority.common (Prarit Bhargava) - redhat/configs: Enable INIT_STACK_ALL_ZERO for Fedora (Miko Larsson) - redhat: Set CONFIG_MAXLINEAR_GPHY to =m (Petr Oros) - redhat/configs enable CONFIG_INTEL_IFS (David Arcari) - redhat: Remove filter-i686.sh.rhel (Prarit Bhargava) - redhat/Makefile: Set PATCHLIST_URL to none for RHEL/cs9 (Prarit Bhargava) - redhat: remove GL_DISTGIT_USER, RHDISTGIT and unify dist-git cloning (Prarit Bhargava) - redhat/Makefile.variables: Add ADD_COMMITID_TO_VERSION (Prarit Bhargava) - kernel.spec: disable vmlinux.h generation for s390 zfcpdump config (Prarit Bhargava) - perf: Require libbpf 0.6.0 or newer (Prarit Bhargava) - kabi: add stablelist helpers (Prarit Bhargava) - Makefile: add kabi targets (Prarit Bhargava) - kabi: add support for symbol namespaces into check-kabi (Prarit Bhargava) - kabi: ignore new stablelist metadata in show-kabi (Prarit Bhargava) - redhat/Makefile: add dist-assert-tree-clean target (Prarit Bhargava) - redhat/kernel.spec.template: Specify vmlinux.h path when building samples/bpf (Prarit Bhargava) [2041365] - spec: Fix separate tools build (Prarit Bhargava) [2054579] - redhat/scripts: Update merge-subtrees.sh with new subtree location (Prarit Bhargava) - redhat/kernel.spec.template: enable dependencies generation (Prarit Bhargava) - redhat: build and include memfd to kernel-selftests-internal (Prarit Bhargava) [2027506] - redhat/kernel.spec.template: Link perf with --export-dynamic (Prarit Bhargava) - redhat: kernel.spec: selftests: abort on build failure (Prarit Bhargava) - redhat: configs: move CONFIG_SERIAL_MULTI_INSTANTIATE=m settings to common/x86 (Jaroslav Kysela) - configs: enable CONFIG_HP_ILO for aarch64 (Mark Salter) - all: cleanup dell config options (Peter Robinson) - redhat: Include more kunit tests (Nico Pache) - common: some minor cleanups/de-dupe (Peter Robinson) - common: enable INTEGRITY_MACHINE_KEYRING on all configuraitons (Peter Robinson) - Fedora 6.0 configs update (Justin M. Forbes) - redhat/self-test: Ignore .rhpkg.mk files (Prarit Bhargava) - redhat/configs: Enable CONFIG_PRINTK_INDEX on Fedora (Prarit Bhargava) - redhat/configs: Cleanup CONFIG_X86_KERNEL_IBT (Prarit Bhargava) - Fix up SND_CTL debug options (Justin M. Forbes) - redhat: create /boot symvers link if it doesn't exist (Jan Stancek) - redhat: remove duplicate kunit tests in mod-internal.list (Nico Pache) - configs/fedora: Make Fedora work with HNS3 network adapter (Zamir SUN) - redhat/configs/fedora/generic: Enable CONFIG_BLK_DEV_UBLK on Fedora (Richard W.M. Jones) [2122595] - fedora: disable IWLMEI (Peter Robinson) - redhat/configs: enable UINPUT on aarch64 (Benjamin Tissoires) - Fedora 6.0 configs part 1 (Justin M. Forbes) - redhat/Makefile: Always set UPSTREAM (Prarit Bhargava) - redhat/configs: aarch64: Turn on Apple Silicon configs for Fedora (Eric Curtin) - Add cpumask_kunit to mod-internal.list (Justin M. Forbes) - config - consolidate disabled MARCH options on s390x (Dan Horák) - move the baseline arch to z13 for s390x in F-37+ (Dan Horák) - redhat/scripts/rh-dist-git.sh: Fix outdated cvs reference (Prarit Bhargava) - redhat/scripts/expand_srpm.sh: Use Makefile variables (Prarit Bhargava) - redhat/scripts/clone_tree.sh: Use Makefile variables (Prarit Bhargava) - Fedora: arm changes for 6.0, part 1, with some ACPI (Peter Robinson) - redhat/self-test: Fix shellcheck errors (Prarit Bhargava) - redhat/docs: Add dist-brew BUILD_FLAGS information (Prarit Bhargava) - redhat: change the changelog item for upstream merges (Herton R. Krzesinski) - redhat: fix dist-release build number test (Herton R. Krzesinski) - redhat: fix release number bump when dist-release-changed runs (Herton R. Krzesinski) - redhat: use new genlog.sh script to detect changes for dist-release (Herton R. Krzesinski) - redhat: move changelog addition to the spec file back into genspec.sh (Herton R. Krzesinski) - redhat: always add a rebase entry when ark merges from upstream (Herton R. Krzesinski) - redhat: drop merge ark patches hack (Herton R. Krzesinski) - redhat: don't hardcode temporary changelog file (Herton R. Krzesinski) - redhat: split changelog generation from genspec.sh (Herton R. Krzesinski) - redhat: configs: Disable FIE on arm (Jeremy Linton) [2012226] - redhat/Makefile: Clean linux tarballs (Prarit Bhargava) - redhat/configs: Cleanup CONFIG_ACPI_AGDI (Prarit Bhargava) - spec: add cpupower daemon reload on install/upgrade (Jarod Wilson) - redhat: properly handle binary files in patches (Ondrej Mosnacek) - Add python3-setuptools buildreq for perf (Justin M. Forbes) - Add cros_kunit to mod-internal.list (Justin M. Forbes) - Add new tests to mod-internal.list (Justin M. Forbes) - Turn off some Kunit tests in pending (Justin M. Forbes) - Clean up a mismatch in Fedora configs (Justin M. Forbes) - redhat/configs: Sync up Retbleed configs with centos-stream (Waiman Long) - Change CRYPTO_BLAKE2S_X86 from m to y (Justin M. Forbes) - Leave CONFIG_ACPI_VIDEO on for x86 only (Justin M. Forbes) - Fix BLAKE2S_ARM and BLAKE2S_X86 configs in pending (Justin M. Forbes) - Fix pending for ACPI_VIDEO (Justin M. Forbes) - redhat/configs: Fix rm warning on config warnings (Eric Chanudet) - redhat/Makefile: Deprecate PREBUILD_GIT_ONLY variable (Prarit Bhargava) - redhat/Makefile: Deprecate SINGLE_TARBALL variable (Prarit Bhargava) - redhat/Makefile: Deprecate GIT variable (Prarit Bhargava) - Update CONFIG_LOCKDEP_CHAINS_BITS to 18 (cmurf) - Add new FIPS module name and version configs (Vladis Dronov) - redhat/configs/fedora: Make PowerPC's nx-gzip buildin (Jakub Čajka) - omit unused Provides (Dan Horák) - self-test: Add test for DIST=".eln" (Prarit Bhargava) - redhat: Enable CONFIG_LZ4_COMPRESS on Fedora (Prarit Bhargava) - fedora: armv7: enable MMC_STM32_SDMMC (Peter Robinson) - .gitlab-ci.yaml: Add test for dist-get-buildreqs target (Prarit Bhargava) - redhat/docs: Add information on build dependencies (Prarit Bhargava) - redhat/Makefile: Add better pass message for dist-get-buildreqs (Prarit Bhargava) - redhat/Makefile: Provide a better message for system-sb-certs (Prarit Bhargava) - redhat/Makefile: Change dist-buildreq-check to a non-blocking target (Prarit Bhargava) - create-data: Parallelize spec file data (Prarit Bhargava) - create-data.sh: Store SOURCES Makefile variable (Prarit Bhargava) - redhat/Makefile: Split up setup-source target (Prarit Bhargava) - create-data.sh: Redefine varfilename (Prarit Bhargava) - create-data.sh: Parallelize variable file creation (Prarit Bhargava) - redhat/configs: Enable CONFIG_LZ4_COMPRESS (Prarit Bhargava) - redhat/docs: Update brew information (Prarit Bhargava) - redhat/Makefile: Fix eln BUILD_TARGET (Prarit Bhargava) - redhat/Makefile: Set BUILD_TARGET for dist-brew (Prarit Bhargava) - kernel.spec.template: update (s390x) expoline.o path (Joe Lawrence) - fedora: enable BCM_NET_PHYPTP (Peter Robinson) - Fedora 5.19 configs update part 2 (Justin M. Forbes) - redhat/Makefile: Change fedora BUILD_TARGET (Prarit Bhargava) - New configs in security/keys (Fedora Kernel Team) - Fedora: arm: enable a pair of drivers (Peter Robinson) - redhat: make kernel-zfcpdump-core to not provide kernel-core/kernel (Herton R. Krzesinski) - redhat/configs: Enable QAT devices for arches other than x86 (Vladis Dronov) - Fedora 5.19 configs pt 1 (Justin M. Forbes) - redhat: Exclude cpufreq.h from kernel-headers (Patrick Talbert) - Add rtla subpackage for kernel-tools (Justin M. Forbes) - fedora: arm: enable a couple of QCom drivers (Peter Robinson) - redhat/Makefile: Deprecate BUILD_SCRATCH_TARGET (Prarit Bhargava) - redhat: enable CONFIG_DEVTMPFS_SAFE (Mark Langsdorf) - redhat/Makefile: Remove deprecated variables and targets (Prarit Bhargava) - Split partner modules into a sub-package (Alice Mitchell) - Enable kAFS and it's dependancies in RHEL (Alice Mitchell) - Enable Marvell OcteonTX2 crypto device in ARK (Vladis Dronov) - redhat/Makefile: Remove --scratch from BUILD_TARGET (Prarit Bhargava) - redhat/Makefile: Fix dist-brew and distg-brew targets (Prarit Bhargava) - fedora: arm64: Initial support for TI Keystone 3 (ARCH_K3) (Peter Robinson) - fedora: arm: enable Hardware Timestamping Engine support (Peter Robinson) - fedora: wireless: disable SiLabs and PureLiFi (Peter Robinson) - fedora: updates for 5.19 (Peter Robinson) - fedora: minor updates for Fedora configs (Peter Robinson) - configs/fedora: Enable the pinctrl SC7180 driver built-in (Enric Balletbo i Serra) - redhat/configs: enable CONFIG_DEBUG_NET for debug kernel (Hangbin Liu) - redhat/Makefile: Add SPECKABIVERSION variable (Prarit Bhargava) - redhat/self-test: Provide better failure output (Prarit Bhargava) - redhat/self-test: Reformat tests to kernel standard (Prarit Bhargava) - redhat/self-test: Add purpose and header to each test (Prarit Bhargava) - Drop outdated CRYPTO_ECDH configs (Vladis Dronov) - Brush up crypto SHA512 and USER configs (Vladis Dronov) - Brush up crypto ECDH and ECDSA configs (Vladis Dronov) - redhat/self-test: Update data set (Prarit Bhargava) - create-data.sh: Reduce specfile data output (Prarit Bhargava) - redhat/configs: restore/fix core INTEL_LPSS configs to be builtin again (Hans de Goede) - Enable CKI on os-build MRs only (Don Zickus) - self-test: Fixup Makefile contents test (Prarit Bhargava) - redhat/self-test: self-test data update (Prarit Bhargava) - redhat/self-test: Fix up create-data.sh to not report local variables (Prarit Bhargava) - redhat/configs/fedora: Enable a set of modules used on some x86 tablets (Hans de Goede) - redhat/configs: Make INTEL_SOC_PMIC_CHTDC_TI builtin (Hans de Goede) - redhat/configs/fedora: enable missing modules modules for Intel IPU3 camera support (Hans de Goede) - Common: minor cleanups (Peter Robinson) - fedora: some minor Fedora cleanups (Peter Robinson) - fedora: drop X86_PLATFORM_DRIVERS_DELL dupe (Peter Robinson) - redhat: change tools_make macro to avoid full override of variables in Makefile (Herton R. Krzesinski) - Fix typo in Makefile for Fedora Stable Versioning (Justin M. Forbes) - Remove duplicates from ark/generic/s390x/zfcpdump/ (Vladis Dronov) - Move common/debug/s390x/zfcpdump/ configs to ark/debug/s390x/zfcpdump/ (Vladis Dronov) - Move common/generic/s390x/zfcpdump/ configs to ark/generic/s390x/zfcpdump/ (Vladis Dronov) - Drop RCU_EXP_CPU_STALL_TIMEOUT to 0, we are not really android (Justin M. Forbes) - redhat/configs/README: Update the README (Prarit Bhargava) - redhat/docs: fix hyperlink typo (Patrick Talbert) - all: net: remove old NIC/ATM drivers that use virt_to_bus() (Peter Robinson) - Explicitly turn off CONFIG_KASAN_INLINE for ppc (Justin M. Forbes) - redhat/docs: Add a description of kernel naming (Prarit Bhargava) - Change CRYPTO_CHACHA_S390 from m to y (Justin M. Forbes) - enable CONFIG_NET_ACT_CTINFO in ark (Davide Caratti) - redhat/configs: enable CONFIG_SP5100_TCO (David Arcari) - redhat/configs: Set CONFIG_VIRTIO_IOMMU on x86_64 (Eric Auger) [2089765] - Turn off KASAN_INLINE for RHEL ppc in pending (Justin M. Forbes) - redhat/kernel.spec.template: update selftest data via "make dist-self-test-data" (Denys Vlasenko) - redhat/kernel.spec.template: remove stray *.hardlink-temporary files, if any (Denys Vlasenko) - Fix up ZSMALLOC config for s390 (Justin M. Forbes) - Turn on KASAN_OUTLINE for ppc debug (Justin M. Forbes) - Turn on KASAN_OUTLINE for PPC debug to avoid mismatch (Justin M. Forbes) - Fix up crypto config mistmatches (Justin M. Forbes) - Fix up config mismatches (Justin M. Forbes) - generic/fedora: cleanup and disable Lightning Moutain SoC (Peter Robinson) - redhat: Set SND_SOC_SOF_HDA_PROBES to =m (Patrick Talbert) - Fix versioning on stable Fedora (Justin M. Forbes) - Enable PAGE_POOL_STATS for arm only (Justin M. Forbes) - Revert "Merge branch 'fix-ci-20220523' into 'os-build'" (Patrick Talbert) - Flip CONFIG_RADIO_ADAPTERS to module for Fedora (Justin M. Forbes) - redhat/Makefile: Drop quotation marks around string definitions (Prarit Bhargava) - Fedora: arm: Updates for QCom devices (Peter Robinson) - Fedora arm and generic updates for 5.17 (Peter Robinson) - enable COMMON_CLK_SI5341 for Xilinx ZYNQ-MP (Peter Robinson) - Turn on CONFIG_DM_VERITY_VERIFY_ROOTHASH_SIG_SECONDARY_KEYRING for Fedora (Justin M. Forbes) - redhat/self-test/data: Update data set (Prarit Bhargava) - Revert variable switch for lasttag (Justin M. Forbes) - redhat: Add self-tests to .gitlab-ci.yml (Prarit Bhargava) - redhat/self-test: Update data (Prarit Bhargava) - redhat/self-test: Unset Makefile variables (Prarit Bhargava) - redhat/self-test: Omit SHELL variable from test data (Prarit Bhargava) - Add CONFIG_EFI_DXE_MEM_ATTRIBUTES (Justin M. Forbes) - Update filter-modules for mlx5-vfio-pci (Justin M. Forbes) - Fedora configs for 5.18 (Justin M. Forbes) - self-test/data/create-data.sh: Avoid SINGLE_TARBALL warning (Prarit Bhargava) - redhat/Makefile: Rename PREBUILD to UPSTREAMBUILD (Prarit Bhargava) - redhat/Makefile: Rename BUILDID to LOCALVERSION (Prarit Bhargava) - redhat/Makefile: Fix dist-brew & distg-brew targets (Prarit Bhargava) - redhat/Makefile: Reorganize MARKER code (Prarit Bhargava) - redhat/scripts/new_release.sh: Use Makefile variables (Prarit Bhargava) - redhat/Makefile: Rename __YSTREAM and __ZSTREAM (Prarit Bhargava) - redhat/genspec.sh: Add comment about SPECBUILDID variable (Prarit Bhargava) - redhat/kernel.spec.template: Move genspec variables into one section (Prarit Bhargava) - redhat/kernel.spec.template: Remove kversion (Prarit Bhargava) - redhat/Makefile: Add SPECTARFILE_RELEASE comment (Prarit Bhargava) - redhat/Makefile: Rename RPMVERSION to BASEVERSION (Prarit Bhargava) - redhat/Makefile: Target whitespace cleanup (Prarit Bhargava) - redhat/Makefile: Move SPECRELEASE to genspec.sh (Prarit Bhargava) - redhat/Makefile: Add kernel-NVR comment (Prarit Bhargava) - redhat/Makefile: Use SPECFILE variable (Prarit Bhargava) - redhat/Makefile: Remove KEXTRAVERSION (Prarit Bhargava) - redhat: Enable VM kselftests (Nico Pache) [1978539] - redhat: enable CONFIG_TEST_VMALLOC for vm selftests (Nico Pache) - redhat: Enable HMM test to be used by the kselftest test suite (Nico Pache) - redhat/Makefile.variables: Change git hash length to default (Prarit Bhargava) - redhat/Makefile: Drop quotation marks around string definitions (Prarit Bhargava) - Turn on INTEGRITY_MACHINE_KEYRING for Fedora (Justin M. Forbes) - redhat/configs: fix CONFIG_INTEL_ISHTP_ECLITE (David Arcari) - redhat/configs: Fix rm warning on error (Prarit Bhargava) - Fix nightly merge CI (Don Zickus) - redhat/kernel.spec.template: fix standalone tools build (Jan Stancek) - Add system-sb-certs for RHEL-9 (Don Zickus) - Fix dist-buildcheck-reqs (Don Zickus) - move DAMON configs to correct directory (Chris von Recklinghausen) - redhat: indicate HEAD state in tarball/rpm name (Jarod Wilson) - Fedora 5.18 config set part 1 (Justin M. Forbes) - fedora: arm: Enable new Rockchip 356x series drivers (Peter Robinson) - fedora: arm: enable DRM_I2C_NXP_TDA998X on aarch64 (Peter Robinson) - redhat/self-test: Add test to verify Makefile declarations. (Prarit Bhargava) - redhat/Makefile: Add RHTEST (Prarit Bhargava) - redhat: shellcheck cleanup (Prarit Bhargava) - redhat/self-test/data: Cleanup data (Prarit Bhargava) - redhat/self-test: Add test to verify SPEC variables (Prarit Bhargava) - redhat/Makefile: Add 'duplicate' SPEC entries for user set variables (Prarit Bhargava) - redhat/Makefile: Rename TARFILE_RELEASE to SPECTARFILE_RELEASE (Prarit Bhargava) - redhat/genspec: Rename PATCHLIST_CHANGELOG to SPECPATCHLIST_CHANGELOG (Prarit Bhargava) - redhat/genspec: Rename DEBUG_BUILDS_ENABLED to SPECDEBUG_BUILDS_ENABLED (Prarit Bhargava) - redhat/Makefile: Rename PKGRELEASE to SPECBUILD (Prarit Bhargava) - redhat/genspec: Rename BUILDID_DEFINE to SPECBUILDID (Prarit Bhargava) - redhat/Makefile: Rename CHANGELOG to SPECCHANGELOG (Prarit Bhargava) - redhat/Makefile: Rename RPMKEXTRAVERSION to SPECKEXTRAVERSION (Prarit Bhargava) - redhat/Makefile: Rename RPMKSUBLEVEL to SPECKSUBLEVEL (Prarit Bhargava) - redhat/Makefile: Rename RPMKPATCHLEVEL to SPECKPATCHLEVEL (Prarit Bhargava) - redhat/Makefile: Rename RPMKVERSION to SPECKVERSION (Prarit Bhargava) - redhat/Makefile: Rename KVERSION to SPECVERSION (Prarit Bhargava) - redhat/Makefile: Deprecate some simple targets (Prarit Bhargava) - redhat/Makefile: Use KVERSION (Prarit Bhargava) - redhat/configs: Set GUP_TEST in debug kernel (Joel Savitz) - enable DAMON configs (Chris von Recklinghausen) [2004233] - redhat: add zstream switch for zstream release numbering (Herton R. Krzesinski) - redhat: change kabi tarballs to use the package release (Herton R. Krzesinski) - redhat: generate distgit changelog in genspec.sh as well (Herton R. Krzesinski) - redhat: make genspec prefer metadata from git notes (Herton R. Krzesinski) - redhat: use tags from git notes for zstream to generate changelog (Herton R. Krzesinski) - ARK: Remove code marking devices unmaintained (Peter Georg) - rh_message: Fix function name (Peter Georg) [2019377] - Turn on CONFIG_RANDOM_TRUST_BOOTLOADER (Justin M. Forbes) - redhat/configs: aarch64: enable CPU_FREQ_GOV_SCHEDUTIL (Mark Salter) - Move CONFIG_HW_RANDOM_CN10K to a proper place (Vladis Dronov) - redhat/self-test: Clean up data set (Prarit Bhargava) - redhat/Makefile.rhpkg: Remove quotes for RHDISTGIT (Prarit Bhargava) - redhat/scripts/create-tarball.sh: Use Makefile variables (Prarit Bhargava) - redhat/Makefile: Deprecate SINGLE_TARBALL (Prarit Bhargava) - redhat/Makefile: Move SINGLE_TARBALL to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Use RPMVERSION (Prarit Bhargava) - redhat/scripts/rh-dist-git.sh: Use Makefile variables (Prarit Bhargava) - redhat/configs/build_configs.sh: Use Makefile variables (Prarit Bhargava) - redhat/configs/process_configs.sh: Use Makefile variables (Prarit Bhargava) - redhat/kernel.spec.template: Use RPM_BUILD_NCPUS (Prarit Bhargava) - redhat/configs/generate_all_configs.sh: Use Makefile variables (Prarit Bhargava) - redhat/configs: enable nf_tables SYNPROXY extension on ark (Davide Caratti) - fedora: Disable fbdev drivers missed before (Javier Martinez Canillas) - Redhat: enable Kfence on production servers (Nico Pache) - redhat: ignore known empty patches on the patches rpminspect test (Herton R. Krzesinski) - kernel-ark: arch_hw Update CONFIG_MOUSE_VSXXXAA=m (Tony Camuso) [2062909] - spec: keep .BTF section in modules for s390 (Yauheni Kaliuta) [2071969] - kernel.spec.template: Ship arch/s390/lib/expoline.o in kernel-devel (Ondrej Mosnacek) - redhat: disable tv/radio media device infrastructure (Jarod Wilson) - redhat/configs: clean up INTEL_LPSS configuration (David Arcari) - Have to rename the actual contents too (Justin M. Forbes) - The CONFIG_SATA_MOBILE_LPM_POLICY rebane was reverted (Justin M. Forbes) - redhat: Enable KASAN on all ELN debug kernels (Nico Pache) - redhat: configs: Enable INTEL_IOMMU_DEBUGFS for debug builds (Jerry Snitselaar) - generic: can: disable CAN_SOFTING everywhere (Peter Robinson) - redhat/configs: Enable CONFIG_DM_ERA=m for all (Yanko Kaneti) - redhat/configs: enable CONFIG_SAMPLE_VFIO_MDEV_MTTY (Patrick Talbert) - Build intel_sdsi with %{tools_make} (Justin M. Forbes) - configs: remove redundant Fedora config for INTEL_IDXD_COMPAT (Jerry Snitselaar) - redhat/configs: enable CONFIG_RANDOMIZE_KSTACK_OFFSET_DEFAULT (Joel Savitz) [2026319] - configs: enable CONFIG_RMI4_F3A (Benjamin Tissoires) - redhat: configs: Disable TPM 1.2 specific drivers (Jerry Snitselaar) - redhat/configs: Enable cr50 I2C TPM interface (Akihiko Odaki) - spec: make HMAC file encode relative path (Jonathan Lebon) - redhat/kernel.spec.template: Add intel_sdsi utility (Prarit Bhargava) - Spec fixes for intel-speed-select (Justin M. Forbes) - Add Partner Supported taint flag to kAFS (Alice Mitchell) [2038999] - Add Partner Supported taint flag (Alice Mitchell) [2038999] - Enabled INTEGRITY_MACHINE_KEYRING for all configs. (Peter Robinson) - redhat/configs: Enable CONFIG_RCU_SCALE_TEST & CONFIG_RCU_REF_SCALE_TEST (Waiman Long) - Add clk_test and clk-gate_test to mod-internal.list (Justin M. Forbes) - redhat/self-tests: Ignore UPSTREAM (Prarit Bhargava) - redhat/self-tests: Ignore RHGITURL (Prarit Bhargava) - redhat/Makefile.variables: Extend git hash length to 15 (Prarit Bhargava) - redhat/self-test: Remove changelog from spec files (Prarit Bhargava) - redhat/genspec.sh: Rearrange genspec.sh (Prarit Bhargava) - redhat/self-test: Add spec file data (Prarit Bhargava) - redhat/self-test: Add better dist-dump-variables test (Prarit Bhargava) - redhat/self-test: Add variable test data (Prarit Bhargava) - redhat/config: Remove obsolete CONFIG_MFD_INTEL_PMT (David Arcari) - redhat/configs: enable CONFIG_INTEL_ISHTP_ECLITE (David Arcari) - Avoid creating files in $RPM_SOURCE_DIR (Nicolas Chauvet) - Flip CRC64 from off to y (Justin M. Forbes) - New configs in lib/Kconfig (Fedora Kernel Team) - disable redundant assignment of CONFIG_BQL on ARK (Davide Caratti) - redhat/configs: remove unnecessary GPIO options for aarch64 (Brian Masney) - redhat/configs: remove viperboard related Kconfig options (Brian Masney) - redhat/configs/process_configs.sh: Avoid race with find (Prarit Bhargava) - redhat/configs/process_configs.sh: Remove CONTINUEONERROR (Prarit Bhargava) - Remove i686 configs and filters (Justin M. Forbes) - redhat/configs: Set CONFIG_X86_AMD_PSTATE built-in on Fedora (Prarit Bhargava) - Fix up mismatch with CRC64 (Justin M. Forbes) - Fedora config updates to fix process_configs (Justin M. Forbes) - redhat: Fix release tagging (Prarit Bhargava) - redhat/self-test: Fix version tag test (Prarit Bhargava) - redhat/self-test: Fix BUILD verification test (Prarit Bhargava) - redhat/self-test: Cleanup SRPM related self-tests (Prarit Bhargava) - redhat/self-test: Fix shellcheck test (Prarit Bhargava) - redhat/configs: Disable watchdog components (Prarit Bhargava) - redhat/README.Makefile: Add a Makefile README file (Prarit Bhargava) - redhat/Makefile: Remove duplicated code (Prarit Bhargava) - Add BuildRequires libnl3-devel for intel-speed-select (Justin M. Forbes) - Add new kunit tests for 5.18 to mod-internal.list (Justin M. Forbes) - Fix RHDISTGIT for Fedora (Justin M. Forbes) - redhat/configs/process_configs.sh: Fix race with tools generation (Prarit Bhargava) - New configs in drivers/dax (Fedora Kernel Team) - Fix up CONFIG_SND_AMD_ACP_CONFIG files (Patrick Talbert) - Remove CONFIG_SND_SOC_SOF_DEBUG_PROBES files (Patrick Talbert) - SATA_MOBILE_LPM_POLICY is now SATA_LPM_POLICY (Justin M. Forbes) - Define SNAPSHOT correctly when VERSION_ON_UPSTREAM is 0 (Justin M. Forbes) - redhat/Makefile: Fix dist-git (Prarit Bhargava) - Change the pending-ark CONFIG_DAX to y due to mismatch (Justin M. Forbes) - Enable net reference count trackers in all debug kernels (Jiri Benc) - redhat/Makefile: Reorganize variables (Prarit Bhargava) - redhat/Makefile: Add some descriptions (Prarit Bhargava) - redhat/Makefile: Move SNAPSHOT check (Prarit Bhargava) - redhat/Makefile: Deprecate BREW_FLAGS, KOJI_FLAGS, and TEST_FLAGS (Prarit Bhargava) - redhat/genspec.sh: Rework RPMVERSION variable (Prarit Bhargava) - redhat/Makefile: Remove dead comment (Prarit Bhargava) - redhat/Makefile: Cleanup KABI* variables. (Prarit Bhargava) - redhat/Makefile.variables: Default RHGITCOMMIT to HEAD (Prarit Bhargava) - redhat/scripts/create-tarball.sh: Use Makefile TARBALL variable (Prarit Bhargava) - redhat/Makefile: Remove extra DIST_BRANCH (Prarit Bhargava) - redhat/Makefile: Remove STAMP_VERSION (Prarit Bhargava) - redhat/Makefile: Move NO_CONFIGCHECKS to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move RHJOBS to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move RHGIT* variables to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move PREBUILD_GIT_ONLY to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move BUILD to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move BUILD_FLAGS to Makefile.variables. (Prarit Bhargava) - redhat/Makefile: Move BUILD_PROFILE to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move BUILD_TARGET and BUILD_SCRATCH_TARGET to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Remove RHPRODUCT variable (Prarit Bhargava) - redhat/Makefile: Cleanup DISTRO variable (Prarit Bhargava) - redhat/Makefile: Move HEAD to Makefile.variables. (Prarit Bhargava) - redhat: Combine Makefile and Makefile.common (Prarit Bhargava) - redhat/koji/Makefile: Decouple koji Makefile from Makefile.common (Prarit Bhargava) - Set CONFIG_SND_SOC_SOF_MT8195 for Fedora and turn on VDPA_SIM_BLOCK (Justin M. Forbes) - Add asus_wmi_sensors modules to filters for Fedora (Justin M. Forbes) - redhat: spec: trigger dracut when modules are installed separately (Jan Stancek) - Last of the Fedora 5.17 configs initial pass (Justin M. Forbes) - redhat/Makefile: Silence dist-clean-configs output (Prarit Bhargava) - Fedora 5.17 config updates (Justin M. Forbes) - Setting CONFIG_I2C_SMBUS to "m" for ark (Gopal Tiwari) - Print arch with process_configs errors (Justin M. Forbes) - Pass RHJOBS to process_configs for dist-configs-check as well (Justin M. Forbes) - redhat/configs/process_configs.sh: Fix issue with old error files (Prarit Bhargava) - redhat/configs/build_configs.sh: Parallelize execution (Prarit Bhargava) - redhat/configs/build_configs.sh: Provide better messages (Prarit Bhargava) - redhat/configs/build_configs.sh: Create unique output files (Prarit Bhargava) - redhat/configs/build_configs.sh: Add local variables (Prarit Bhargava) - redhat/configs/process_configs.sh: Parallelize execution (Prarit Bhargava) - redhat/configs/process_configs.sh: Provide better messages (Prarit Bhargava) - redhat/configs/process_configs.sh: Create unique output files (Prarit Bhargava) - redhat/configs/process_configs.sh: Add processing config function (Prarit Bhargava) - redhat: Unify genspec.sh and kernel.spec variable names (Prarit Bhargava) - redhat/genspec.sh: Remove options and use Makefile variables (Prarit Bhargava) - Add rebase note for 5.17 on Fedora stable (Justin M. Forbes) - More Fedora config updates for 5.17 (Justin M. Forbes) - redhat/configs: Disable CONFIG_MACINTOSH_DRIVERS in RHEL. (Prarit Bhargava) - redhat: Fix "make dist-release-finish" to use the correct NVR variables (Neal Gompa) [2053836] - Build CROS_EC Modules (Jason Montleon) - redhat: configs: change aarch64 default dma domain to lazy (Jerry Snitselaar) - redhat: configs: disable ATM protocols (Davide Caratti) - configs/fedora: Enable the interconnect SC7180 driver built-in (Enric Balletbo i Serra) - configs: clean up CONFIG_PAGE_TABLE_ISOLATION files (Ondrej Mosnacek) - redhat: configs: enable CONFIG_INTEL_PCH_THERMAL for RHEL x86 (David Arcari) - redhat/Makefile: Fix dist-dump-variables target (Prarit Bhargava) - redhat/configs: Enable DEV_DAX and DEV_DAX_PMEM modules on aarch64 for fedora (D Scott Phillips) - redhat/configs: Enable CONFIG_TRANSPARENT_HUGEPAGE on aarch64 for fedora (D Scott Phillips) - configs/process_configs.sh: Remove orig files (Prarit Bhargava) - redhat: configs: Disable CONFIG_MPLS for s390x/zfcpdump (Guillaume Nault) - Fedora 5.17 configs round 1 (Justin M. Forbes) - redhat: configs: disable the surface platform (David Arcari) - redhat: configs: Disable team driver (Hangbin Liu) [1945477] - configs: enable LOGITECH_FF for RHEL/CentOS too (Benjamin Tissoires) - redhat/configs: Disable CONFIG_SENSORS_NCT6683 in RHEL for arm/aarch64 (Dean Nelson) [2041186] - redhat: fix make {distg-brew,distg-koji} (Andrea Claudi) - [fedora] Turn on CONFIG_VIDEO_OV5693 for sensor support (Dave Olsthoorn) - Cleanup 'disabled' config options for RHEL (Prarit Bhargava) - redhat: move CONFIG_ARM64_MTE to aarch64 config directory (Herton R. Krzesinski) - Change CONFIG_TEST_BPF to a module (Justin M. Forbes) - Change CONFIG_TEST_BPF to module in pending MR coming for proper review (Justin M. Forbes) - redhat/configs: Enable CONFIG_TEST_BPF (Viktor Malik) - Enable KUNIT tests for testing (Nico Pache) - Makefile: Check PKGRELEASE size on dist-brew targets (Prarit Bhargava) - kernel.spec: Add glibc-static build requirement (Prarit Bhargava) - Enable iSER on s390x (Stefan Schulze Frielinghaus) - redhat/configs: Enable CONFIG_ACER_WIRELESS (Peter Georg) [2025985] - kabi: Add kABI macros for enum type (Čestmír Kalina) [2024595] - kabi: expand and clarify documentation of aux structs (Čestmír Kalina) [2024595] - kabi: introduce RH_KABI_USE_AUX_PTR (Čestmír Kalina) [2024595] - kabi: rename RH_KABI_SIZE_AND_EXTEND to AUX (Čestmír Kalina) [2024595] - kabi: more consistent _RH_KABI_SIZE_AND_EXTEND (Čestmír Kalina) [2024595] - kabi: use fixed field name for extended part (Čestmír Kalina) [2024595] - kabi: fix dereference in RH_KABI_CHECK_EXT (Čestmír Kalina) [2024595] - kabi: fix RH_KABI_SET_SIZE macro (Čestmír Kalina) [2024595] - kabi: expand and clarify documentation (Čestmír Kalina) [2024595] - kabi: make RH_KABI_USE replace any number of reserved fields (Čestmír Kalina) [2024595] - kabi: rename RH_KABI_USE2 to RH_KABI_USE_SPLIT (Čestmír Kalina) [2024595] - kabi: change RH_KABI_REPLACE2 to RH_KABI_REPLACE_SPLIT (Čestmír Kalina) [2024595] - kabi: change RH_KABI_REPLACE_UNSAFE to RH_KABI_BROKEN_REPLACE (Čestmír Kalina) [2024595] - kabi: introduce RH_KABI_ADD_MODIFIER (Čestmír Kalina) [2024595] - kabi: Include kconfig.h (Čestmír Kalina) [2024595] - kabi: macros for intentional kABI breakage (Čestmír Kalina) [2024595] - kabi: fix the note about terminating semicolon (Čestmír Kalina) [2024595] - kabi: introduce RH_KABI_HIDE_INCLUDE and RH_KABI_FAKE_INCLUDE (Čestmír Kalina) [2024595] - spec: don't overwrite auto.conf with .config (Ondrej Mosnacek) - New configs in drivers/crypto (Fedora Kernel Team) - Add test_hash to the mod-internal.list (Justin M. Forbes) - configs: disable CONFIG_CRAMFS (Abhi Das) [2041184] - spec: speed up "cp -r" when it overwrites existing files. (Denys Vlasenko) - redhat: use centos x509.genkey file if building under centos (Herton R. Krzesinski) - Revert "[redhat] Generate a crashkernel.default for each kernel build" (Coiby Xu) - spec: make linux-firmware weak(er) dependency (Jan Stancek) - rtw89: enable new driver rtw89 and device RTK8852AE (Íñigo Huguet) - Config consolidation into common (Justin M. Forbes) - Add packaged but empty /lib/modules//systemtap/ (Justin M. Forbes) - filter-modules.sh.rhel: Add ntc_thermistor to singlemods (Prarit Bhargava) - Move CONFIG_SND_SOC_TLV320AIC31XX as it is now selected by CONFIG_SND_SOC_FSL_ASOC_CARD (Justin M. Forbes) - Add dev_addr_lists_test to mod-internal.list (Justin M. Forbes) - configs/fedora: Enable CONFIG_NFC_PN532_UART for use PN532 NFC module (Ziqian SUN (Zamir)) - redhat: ignore ksamples and kselftests on the badfuncs rpminspect test (Herton R. Krzesinski) - redhat: disable upstream check for rpminspect (Herton R. Krzesinski) - redhat: switch the vsyscall config to CONFIG_LEGACY_VSYSCALL_XONLY=y (Herton R. Krzesinski) [1876977] - redhat: configs: increase CONFIG_DEBUG_KMEMLEAK_MEM_POOL_SIZE (Rafael Aquini) - move CONFIG_STRICT_SIGALTSTACK_SIZE to the appropriate directory (David Arcari) - redhat/configs: Enable CONFIG_DM_MULTIPATH_IOA for fedora (Benjamin Marzinski) - redhat/configs: Enable CONFIG_DM_MULTIPATH_HST (Benjamin Marzinski) [2000835] - redhat: Pull in openssl-devel as a build dependency correctly (Neal Gompa) [2034670] - redhat/configs: Migrate ZRAM_DEF_* configs to common/ (Neal Gompa) - redhat/configs: Enable CONFIG_CRYPTO_ZSTD (Neal Gompa) [2032758] - Turn CONFIG_DEVMEM back off for aarch64 (Justin M. Forbes) - Clean up excess text in Fedora config files (Justin M. Forbes) - Fedora config updates for 5.16 (Justin M. Forbes) - redhat/configs: enable CONFIG_INPUT_KEYBOARD for AARCH64 (Vitaly Kuznetsov) - Fedora configs for 5.16 pt 1 (Justin M. Forbes) - redhat/configs: NFS: disable UDP, insecure enctypes (Benjamin Coddington) [1952863] - Update rebase-notes with dracut 5.17 information (Justin M. Forbes) - redhat/configs: Enable CONFIG_CRYPTO_BLAKE2B (Neal Gompa) [2031547] - Enable CONFIG_BPF_SYSCALL for zfcpdump (Jiri Olsa) - Enable CONFIG_CIFS_SMB_DIRECT for ARK (Ronnie Sahlberg) - mt76: enable new device MT7921E in CentOs/RHEL (Íñigo Huguet) [2004821] - Disable CONFIG_DEBUG_PREEMPT on normal builds (Phil Auld) - redhat/configs: Enable CONFIG_PCI_P2PDMA for ark (Myron Stowe) - pci.h: Fix static include (Prarit Bhargava) - Enable CONFIG_VFIO_NOIOMMU for Fedora (Justin M. Forbes) - redhat/configs: enable CONFIG_NTB_NETDEV for ark (John W. Linville) - drivers/pci/pci-driver.c: Fix if/ifdef typo (Prarit Bhargava) - common: arm64: ensure all the required arm64 errata are enabled (Peter Robinson) - kernel/rh_taint.c: Update to new messaging (Prarit Bhargava) [2019377] - redhat/configs: enable CONFIG_AMD_PTDMA for ark (John W. Linville) - redhat/configs: enable CONFIG_RD_ZSTD for rhel (Tao Liu) [2020132] - fedora: build TEE as a module for all arches (Peter Robinson) - common: build TRUSTED_KEYS in everywhere (Peter Robinson) - redhat: make Patchlist.changelog generation conditional (Herton R. Krzesinski) - redhat/configs: Add two new CONFIGs (Prarit Bhargava) - redhat/configs: Remove dead CONFIG files (Prarit Bhargava) - redhat/configs/evaluate_configs: Add find dead configs option (Prarit Bhargava) - Add more rebase notes for Fedora 5.16 (Justin M. Forbes) - Fedora: Feature: Retire wireless Extensions (Peter Robinson) - fedora: arm: some SoC enablement pieces (Peter Robinson) - fedora: arm: enable PCIE_ROCKCHIP_DW for rk35xx series (Peter Robinson) - fedora: enable RTW89 802.11 WiFi driver (Peter Robinson) - fedora: arm: Enable DRM_PANEL_EDP (Peter Robinson) - fedora: sound: enable new sound drivers (Peter Robinson) - redhat/configs: unset KEXEC_SIG for s390x zfcpdump (Coiby Xu) - spec: Keep .BTF section in modules (Jiri Olsa) - Fix up PREEMPT configs (Justin M. Forbes) - New configs in drivers/media (Fedora Kernel Team) - New configs in drivers/net/ethernet/litex (Fedora Kernel Team) - spec: add bpf_testmod.ko to kselftests/bpf (Viktor Malik) - New configs in drivers/net/wwan (Fedora Kernel Team) - New configs in drivers/i2c (Fedora Kernel Team) - redhat/docs/index.rst: Add local build information. (Prarit Bhargava) - Fix up preempt configs (Justin M. Forbes) - Turn on CONFIG_HID_NINTENDO for controller support (Dave Olsthoorn) - Fedora: Enable MediaTek bluetooth pieces (Peter Robinson) - Add rebase notes to check for PCI patches (Justin M. Forbes) - redhat: configs: move CONFIG_ACCESSIBILITY from fedora to common (John W. Linville) - Filter updates for hid-playstation on Fedora (Justin M. Forbes) - Enable CONFIG_VIRT_DRIVERS for ARK (Vitaly Kuznetsov) - redhat/configs: Enable Nitro Enclaves on aarch64 (Vitaly Kuznetsov) - Enable e1000 in rhel9 as unsupported (Ken Cox) [2002344] - Turn on COMMON_CLK_AXG_AUDIO for Fedora rhbz 2020481 (Justin M. Forbes) - Fix up fedora config options from mismatch (Justin M. Forbes) - Add nct6775 to filter-modules.sh.rhel (Justin M. Forbes) - Enable PREEMPT_DYNAMIC for all but s390x (Justin M. Forbes) - Add memcpy_kunit to mod-internal.list (Justin M. Forbes) - New configs in fs/ksmbd (Fedora Kernel Team) - Add nct6775 to Fedora filter-modules.sh (Justin M. Forbes) - New configs in fs/ntfs3 (Fedora Kernel Team) - Make CONFIG_IOMMU_DEFAULT_DMA_STRICT default for all but x86 (Justin M. Forbes) - redhat/configs: enable KEXEC_IMAGE_VERIFY_SIG for RHEL (Coiby Xu) - redhat/configs: enable KEXEC_SIG for aarch64 RHEL (Coiby Xu) [1994858] - Fix up fedora and pending configs for PREEMPT to end mismatch (Justin M. Forbes) - Enable binder for fedora (Justin M. Forbes) - redhat: configs: Update configs for vmware (Kamal Heib) - Fedora configs for 5.15 (Justin M. Forbes) - redhat/kernel.spec.template: don't hardcode gcov arches (Jan Stancek) - redhat/configs: create a separate config for gcov options (Jan Stancek) - Update documentation with FAQ and update frequency (Don Zickus) - Document force pull option for mirroring (Don Zickus) - Ignore the rhel9 kabi files (Don Zickus) - Remove legacy elrdy cruft (Don Zickus) - redhat/configs/evaluate_configs: walk cfgvariants line by line (Jan Stancek) - redhat/configs/evaluate_configs: insert EMPTY tags at correct place (Jan Stancek) - redhat: make dist-srpm-gcov add to BUILDOPTS (Jan Stancek) - Build CONFIG_SPI_PXA2XX as a module on x86 (Justin M. Forbes) - redhat/configs: enable CONFIG_BCMGENET as module (Joel Savitz) - Fedora config updates (Justin M. Forbes) - Enable CONFIG_FAIL_SUNRPC for debug builds (Justin M. Forbes) - fedora: Disable fbdev drivers and use simpledrm instead (Javier Martinez Canillas) - spec: Don't fail spec build if ksamples fails (Jiri Olsa) - Enable CONFIG_QCOM_SCM for arm (Justin M. Forbes) - redhat: Disable clang's integrated assembler on ppc64le and s390x (Tom Stellard) - redhat/configs: enable CONFIG_IMA_WRITE_POLICY (Bruno Meneguele) - Fix dist-srpm-gcov (Don Zickus) - redhat: configs: add CONFIG_NTB and related items (John W. Linville) - Add kfence_test to mod-internal.list (Justin M. Forbes) - Enable KUNIT tests for redhat kernel-modules-internal (Nico Pache) - redhat: add *-matched meta packages to rpminspect emptyrpm config (Herton R. Krzesinski) - Use common config for NODES_SHIFT (Mark Salter) - redhat: fix typo and make the output more silent for dist-git sync (Herton R. Krzesinski) - Fedora NTFS config updates (Justin M. Forbes) - Fedora 5.15 configs part 1 (Justin M. Forbes) - Fix ordering in genspec args (Justin M. Forbes) - redhat/configs: Enable Hyper-V guests on ARM64 (Vitaly Kuznetsov) [2007430] - redhat: configs: Enable CONFIG_THINKPAD_LMI (Hans de Goede) - redhat/docs: update Koji link to avoid redirect (Joel Savitz) - redhat: add support for different profiles with dist*-brew (Herton R. Krzesinski) - redhat: configs: Disable xtables and ipset (Phil Sutter) [1945179] - redhat: Add mark_driver_deprecated() (Phil Sutter) [1945179] - Change s390x CONFIG_NODES_SHIFT from 4 to 1 (Justin M. Forbes) - Build CRYPTO_SHA3_*_S390 inline for s390 zfcpdump (Justin M. Forbes) - redhat: move the DIST variable setting to Makefile.variables (Herton R. Krzesinski) - redhat/kernel.spec.template: Cleanup source numbering (Prarit Bhargava) - redhat/kernel.spec.template: Reorganize RHEL and Fedora specific files (Prarit Bhargava) - redhat/kernel.spec.template: Add include_fedora and include_rhel variables (Prarit Bhargava) - redhat/Makefile: Make kernel-local global (Prarit Bhargava) - redhat/Makefile: Use flavors file (Prarit Bhargava) - Turn on CONFIG_CPU_FREQ_GOV_SCHEDUTIL for x86 (Justin M. Forbes) - redhat/configs: Remove CONFIG_INFINIBAND_I40IW (Kamal Heib) - cleanup CONFIG_X86_PLATFORM_DRIVERS_INTEL (David Arcari) - redhat: rename usage of .rhel8git.mk to .rhpkg.mk (Herton R. Krzesinski) - Manually add pending items that need to be set due to mismatch (Justin M. Forbes) - Clean up pending common (Justin M. Forbes) - redhat/configs: Enable CONFIG_BLK_CGROUP_IOLATENCY & CONFIG_BLK_CGROUP_FC_APPID (Waiman Long) [2006813] - redhat: remove kernel.changelog-8.99 file (Herton R. Krzesinski) - redhat/configs: enable CONFIG_SQUASHFS_ZSTD which is already enabled in Fedora 34 (Tao Liu) [1998953] - redhat: bump RHEL_MAJOR and add the changelog file for it (Herton R. Krzesinski) - redhat: add documentation about the os-build rebase process (Herton R. Krzesinski) - redhat/configs: enable SYSTEM_BLACKLIST_KEYRING which is already enabled in rhel8 and Fedora 34 (Coiby Xu) - Build kernel-doc for Fedora (Justin M. Forbes) - x86_64: Enable Elkhart Lake Quadrature Encoder Peripheral support (Prarit Bhargava) - Update CONFIG_WERROR to disabled as it can cause issue with out of tree modules. (Justin M. Forbes) - Fixup IOMMU configs in pending so that configs are sane again (Justin M. Forbes) - Some initial Fedora config items for 5.15 (Justin M. Forbes) - arm64: use common CONFIG_MAX_ZONEORDER for arm kernel (Mark Salter) - Create Makefile.variables for a single point of configuration change (Justin M. Forbes) - rpmspec: drop traceevent files instead of just excluding them from files list (Herton R. Krzesinski) [1967640] - redhat/config: Enablement of CONFIG_PAPR_SCM for PowerPC (Gustavo Walbon) [1962936] - Attempt to fix Intel PMT code (David Arcari) - CI: Enable realtime branch testing (Veronika Kabatova) - CI: Enable realtime checks for c9s and RHEL9 (Veronika Kabatova) - ark: wireless: enable all rtw88 pcie wirless variants (Peter Robinson) - wireless: rtw88: move debug options to common/debug (Peter Robinson) - fedora: minor PTP clock driver cleanups (Peter Robinson) - common: x86: enable VMware PTP support on ark (Peter Robinson) - [scsi] megaraid_sas: re-add certain pci-ids (Tomas Henzl) - Disable liquidio driver on ark/rhel (Herton R. Krzesinski) [1993393] - More Fedora config updates (Justin M. Forbes) - Fedora config updates for 5.14 (Justin M. Forbes) - CI: Rename ARK CI pipeline type (Veronika Kabatova) - CI: Finish up c9s config (Veronika Kabatova) - CI: Update ppc64le config (Veronika Kabatova) - CI: use more templates (Veronika Kabatova) - Filter updates for aarch64 (Justin M. Forbes) - increase CONFIG_NODES_SHIFT for aarch64 (Chris von Recklinghausen) [1890304] - redhat: configs: Enable CONFIG_WIRELESS_HOTKEY (Hans de Goede) - redhat/configs: Update CONFIG_NVRAM (Desnes A. Nunes do Rosario) [1988254] - common: serial: build in SERIAL_8250_LPSS for x86 (Peter Robinson) - powerpc: enable CONFIG_FUNCTION_PROFILER (Diego Domingos) [1831065] - redhat/configs: Disable Soft-RoCE driver (Kamal Heib) - redhat/configs/evaluate_configs: Update help output (Prarit Bhargava) - redhat/configs: Double MAX_LOCKDEP_CHAINS (Justin M. Forbes) - fedora: configs: Fix WM5102 Kconfig (Hans de Goede) - powerpc: enable CONFIG_POWER9_CPU (Diego Domingos) [1876436] - redhat/configs: Fix CONFIG_VIRTIO_IOMMU to 'y' on aarch64 (Eric Auger) [1972795] - filter-modules.sh: add more sound modules to filter (Jaroslav Kysela) - redhat/configs: sound configuration cleanups and updates (Jaroslav Kysela) - common: Update for CXL (Compute Express Link) configs (Peter Robinson) - redhat: configs: disable CRYPTO_SM modules (Herton R. Krzesinski) [1990040] - Remove fedora version of the LOCKDEP_BITS, we should use common (Justin M. Forbes) - Re-enable sermouse for x86 (rhbz 1974002) (Justin M. Forbes) - Fedora 5.14 configs round 1 (Justin M. Forbes) - redhat: add gating configuration for centos stream/rhel9 (Herton R. Krzesinski) - x86: configs: Enable CONFIG_TEST_FPU for debug kernels (Vitaly Kuznetsov) [1988384] - redhat/configs: Move CHACHA and POLY1305 to core kernel to allow BIG_KEYS=y (root) [1983298] - kernel.spec: fix build of samples/bpf (Jiri Benc) - Enable OSNOISE_TRACER and TIMERLAT_TRACER (Jerome Marchand) [1979379] - rpmspec: switch iio and gpio tools to use tools_make (Herton R. Krzesinski) [1956988] - configs/process_configs.sh: Handle config items with no help text (Patrick Talbert) - fedora: sound config updates for 5.14 (Peter Robinson) - fedora: Only enable FSI drivers on POWER platform (Peter Robinson) - The CONFIG_RAW_DRIVER has been removed from upstream (Peter Robinson) - fedora: updates for 5.14 with a few disables for common from pending (Peter Robinson) - fedora: migrate from MFD_TPS68470 -> INTEL_SKL_INT3472 (Peter Robinson) - fedora: Remove STAGING_GASKET_FRAMEWORK (Peter Robinson) - Fedora: move DRM_VMWGFX configs from ark -> common (Peter Robinson) - fedora: arm: disabled unused FB drivers (Peter Robinson) - fedora: don't enable FB_VIRTUAL (Peter Robinson) - redhat/configs: Double MAX_LOCKDEP_ENTRIES (Waiman Long) [1940075] - rpmspec: fix verbose output on kernel-devel installation (Herton R. Krzesinski) [1981406] - Build Fedora x86s kernels with bytcr-wm5102 (Marius Hoch) - Deleted redhat/configs/fedora/generic/x86/CONFIG_FB_HYPERV (Patrick Lang) - rpmspec: correct the ghost initramfs attributes (Herton R. Krzesinski) [1977056] - rpmspec: amend removal of depmod created files to include modules.builtin.alias.bin (Herton R. Krzesinski) [1977056] - configs: remove duplicate CONFIG_DRM_HYPERV file (Patrick Talbert) - CI: use common code for merge and release (Don Zickus) - rpmspec: add release string to kernel doc directory name (Jan Stancek) - redhat/configs: Add CONFIG_INTEL_PMT_CRASHLOG (Michael Petlan) [1880486] - redhat/configs: Add CONFIG_INTEL_PMT_TELEMETRY (Michael Petlan) [1880486] - redhat/configs: Add CONFIG_MFD_INTEL_PMT (Michael Petlan) [1880486] - redhat/configs: enable CONFIG_BLK_DEV_ZONED (Ming Lei) [1638087] - Add --with clang_lto option to build the kernel with Link Time Optimizations (Tom Stellard) - common: disable DVB_AV7110 and associated pieces (Peter Robinson) - Fix fedora-only config updates (Don Zickus) - Fedor config update for new option (Justin M. Forbes) - redhat/configs: Enable stmmac NIC for x86_64 (Mark Salter) - all: hyperv: use the DRM driver rather than FB (Peter Robinson) - all: hyperv: unify the Microsoft HyperV configs (Peter Robinson) - all: VMWare: clean up VMWare configs (Peter Robinson) - Update CONFIG_ARM_FFA_TRANSPORT (Patrick Talbert) - CI: Handle all mirrors (Veronika Kabatova) - Turn on CONFIG_STACKTRACE for s390x zfpcdump kernels (Justin M. Forbes) - arm64: switch ark kernel to 4K pagesize (Mark Salter) - Disable AMIGA_PARTITION and KARMA_PARTITION (Prarit Bhargava) [1802694] - all: unify and cleanup i2c TPM2 modules (Peter Robinson) - redhat/configs: Set CONFIG_VIRTIO_IOMMU on aarch64 (Eric Auger) [1972795] - redhat/configs: Disable CONFIG_RT_GROUP_SCHED in rhel config (Phil Auld) - redhat/configs: enable KEXEC_SIG which is already enabled in RHEL8 for s390x and x86_64 (Coiby Xu) [1976835] - rpmspec: do not BuildRequires bpftool on noarch (Herton R. Krzesinski) - redhat/configs: disable {IMA,EVM}_LOAD_X509 (Bruno Meneguele) [1977529] - redhat: add secureboot CA certificate to trusted kernel keyring (Bruno Meneguele) - redhat/configs: enable IMA_ARCH_POLICY for aarch64 and s390x (Bruno Meneguele) - redhat/configs: Enable CONFIG_MLXBF_GIGE on aarch64 (Alaa Hleihel) [1858599] - common: enable STRICT_MODULE_RWX everywhere (Peter Robinson) - COMMON_CLK_STM32MP157_SCMI is bool and selects COMMON_CLK_SCMI (Justin M. Forbes) - kernel.spec: Add kernel{,-debug}-devel-matched meta packages (Timothée Ravier) - Turn off with_selftests for Fedora (Justin M. Forbes) - Don't build bpftool on Fedora (Justin M. Forbes) - Fix location of syscall scripts for kernel-devel (Justin M. Forbes) - fedora: arm: Enable some i.MX8 options (Peter Robinson) - Enable Landlock for Fedora (Justin M. Forbes) - Filter update for Fedora aarch64 (Justin M. Forbes) - rpmspec: only build debug meta packages where we build debug ones (Herton R. Krzesinski) - rpmspec: do not BuildRequires bpftool on nobuildarches (Herton R. Krzesinski) - redhat/configs: Consolidate CONFIG_HMC_DRV in the common s390x folder (Thomas Huth) [1976270] - redhat/configs: Consolidate CONFIG_EXPOLINE_OFF in the common folder (Thomas Huth) [1976270] - redhat/configs: Move CONFIG_HW_RANDOM_S390 into the s390x/ subfolder (Thomas Huth) [1976270] - redhat/configs: Disable CONFIG_HOTPLUG_PCI_SHPC in the Fedora settings (Thomas Huth) [1976270] - redhat/configs: Remove the non-existent CONFIG_NO_BOOTMEM switch (Thomas Huth) [1976270] - redhat/configs: Compile the virtio-console as a module on s390x (Thomas Huth) [1976270] - redhat/configs: Enable CONFIG_S390_CCW_IOMMU and CONFIG_VFIO_CCW for ARK, too (Thomas Huth) [1976270] - Revert "Merge branch 'ec_fips' into 'os-build'" (Vladis Dronov) [1947240] - Fix typos in fedora filters (Justin M. Forbes) - More filtering for Fedora (Justin M. Forbes) - Fix Fedora module filtering for spi-altera-dfl (Justin M. Forbes) - Fedora 5.13 config updates (Justin M. Forbes) - fedora: cleanup TCG_TIS_I2C_CR50 (Peter Robinson) - fedora: drop duplicate configs (Peter Robinson) - More Fedora config updates for 5.13 (Justin M. Forbes) - redhat/configs: Enable needed drivers for BlueField SoC on aarch64 (Alaa Hleihel) [1858592 1858594 1858596] - redhat: Rename mod-blacklist.sh to mod-denylist.sh (Prarit Bhargava) - redhat/configs: enable CONFIG_NET_ACT_MPLS (Marcelo Ricardo Leitner) - configs: Enable CONFIG_DEBUG_KERNEL for zfcpdump (Jiri Olsa) - kernel.spec: Add support to use vmlinux.h (Don Zickus) - spec: Add vmlinux.h to kernel-devel package (Jiri Olsa) - Turn off DRM_XEN_FRONTEND for Fedora as we had DRM_XEN off already (Justin M. Forbes) - Fedora 5.13 config updates pt 3 (Justin M. Forbes) - all: enable ath11k wireless modules (Peter Robinson) - all: Enable WWAN and associated MHI bus pieces (Peter Robinson) - spec: Enable sefltests rpm build (Jiri Olsa) - spec: Allow bpf selftest/samples to fail (Jiri Olsa) - kvm: Add kvm_stat.service file and kvm_stat logrotate config to the tools (Jiri Benc) - kernel.spec: Add missing source files to kernel-selftests-internal (Jiri Benc) - kernel.spec: selftests: add net/forwarding to TARGETS list (Jiri Benc) - kernel.spec: selftests: add build requirement on libmnl-devel (Jiri Benc) - kernel.spec: add action.o to kernel-selftests-internal (Jiri Benc) - kernel.spec: avoid building bpftool repeatedly (Jiri Benc) - kernel.spec: selftests require python3 (Jiri Benc) - kernel.spec: skip selftests that failed to build (Jiri Benc) - kernel.spec: fix installation of bpf selftests (Jiri Benc) - redhat: fix samples and selftests make options (Jiri Benc) - kernel.spec: enable mptcp selftests for kernel-selftests-internal (Jiri Benc) - kernel.spec: Do not export shared objects from libexecdir to RPM Provides (Jiri Benc) - kernel.spec: add missing dependency for the which package (Jiri Benc) - kernel.spec: add netfilter selftests to kernel-selftests-internal (Jiri Benc) - kernel.spec: move slabinfo and page_owner_sort debuginfo to tools-debuginfo (Jiri Benc) - kernel.spec: package and ship VM tools (Jiri Benc) - configs: enable CONFIG_PAGE_OWNER (Jiri Benc) - kernel.spec: add coreutils (Jiri Benc) - kernel.spec: add netdevsim driver selftests to kernel-selftests-internal (Jiri Benc) - redhat/Makefile: Clean out the --without flags from the baseonly rule (Jiri Benc) - kernel.spec: Stop building unnecessary rpms for baseonly builds (Jiri Benc) - kernel.spec: disable more kabi switches for gcov build (Jiri Benc) - kernel.spec: Rename kabi-dw base (Jiri Benc) - kernel.spec: Fix error messages during build of zfcpdump kernel (Jiri Benc) - kernel.spec: perf: remove bpf examples (Jiri Benc) - kernel.spec: selftests should not depend on modules-internal (Jiri Benc) - kernel.spec: build samples (Jiri Benc) - kernel.spec: tools: sync missing options with RHEL 8 (Jiri Benc) - redhat/configs: nftables: Enable extra flowtable symbols (Phil Sutter) - redhat/configs: Sync netfilter options with RHEL8 (Phil Sutter) - Fedora 5.13 config updates pt 2 (Justin M. Forbes) - Move CONFIG_ARCH_INTEL_SOCFPGA up a level for Fedora (Justin M. Forbes) - fedora: enable the Rockchip rk3399 pcie drivers (Peter Robinson) - Fedora 5.13 config updates pt 1 (Justin M. Forbes) - Fix version requirement from opencsd-devel buildreq (Justin M. Forbes) - configs/ark/s390: set CONFIG_MARCH_Z14 and CONFIG_TUNE_Z15 (Philipp Rudo) [1876435] - configs/common/s390: Clean up CONFIG_{MARCH,TUNE}_Z* (Philipp Rudo) - configs/process_configs.sh: make use of dummy-tools (Philipp Rudo) - configs/common: disable CONFIG_INIT_STACK_ALL_{PATTERN,ZERO} (Philipp Rudo) - configs/common/aarch64: disable CONFIG_RELR (Philipp Rudo) - redhat/config: enable STMICRO nic for RHEL (Mark Salter) - redhat/configs: Enable ARCH_TEGRA on RHEL (Mark Salter) - redhat/configs: enable IMA_KEXEC for supported arches (Bruno Meneguele) - redhat/configs: enable INTEGRITY_SIGNATURE to all arches (Bruno Meneguele) - configs: enable CONFIG_LEDS_BRIGHTNESS_HW_CHANGED (Benjamin Tissoires) - RHEL: disable io_uring support (Jeff Moyer) [1964537] - all: Changing CONFIG_UV_SYSFS to build uv_sysfs.ko as a loadable module. (Frank Ramsay) - Enable NITRO_ENCLAVES on RHEL (Vitaly Kuznetsov) - Update the Quick Start documentation (David Ward) - redhat/configs: Set PVPANIC_MMIO for x86 and PVPANIC_PCI for aarch64 (Eric Auger) [1961178] - bpf: Fix unprivileged_bpf_disabled setup (Jiri Olsa) - Enable CONFIG_BPF_UNPRIV_DEFAULT_OFF (Jiri Olsa) - configs/common/s390: disable CONFIG_QETH_{OSN,OSX} (Philipp Rudo) [1903201] - nvme: nvme_mpath_init remove multipath check (Mike Snitzer) - Make CRYPTO_EC also builtin (Simo Sorce) [1947240] - Do not hard-code a default value for DIST (David Ward) - Override %{debugbuildsenabled} if the --with-release option is used (David Ward) - Improve comments in SPEC file, and move some option tests and macros (David Ward) - configs: enable CONFIG_EXFAT_FS (Pavel Reichl) [1943423] - Revert s390x/zfcpdump part of a9d179c40281 and ecbfddd98621 (Vladis Dronov) - Embed crypto algos, modes and templates needed in the FIPS mode (Vladis Dronov) [1947240] - configs: Add and enable CONFIG_HYPERV_TESTING for debug kernels (Mohammed Gamal) - configs: enable CONFIG_CMA on x86_64 in ARK (David Hildenbrand) [1945002] - rpmspec: build debug-* meta-packages if debug builds are disabled (Herton R. Krzesinski) - UIO: disable unused config options (Aristeu Rozanski) [1957819] - ARK-config: Make amd_pinctrl module builtin (Hans de Goede) - rpmspec: revert/drop content hash for kernel-headers (Herton R. Krzesinski) - rpmspec: fix check that calls InitBuildVars (Herton R. Krzesinski) - fedora: enable zonefs (Damien Le Moal) - redhat: load specific ARCH keys to INTEGRITY_PLATFORM_KEYRING (Bruno Meneguele) - redhat: enable INTEGRITY_TRUSTED_KEYRING across all variants (Bruno Meneguele) - redhat: enable SYSTEM_BLACKLIST_KEYRING across all variants (Bruno Meneguele) - redhat: enable INTEGRITY_ASYMMETRIC_KEYS across all variants (Bruno Meneguele) - Remove unused boot loader specification files (David Ward) - redhat/configs: Enable mlx5 IPsec and TLS offloads (Alaa Hleihel) [1869674 1957636] - common: disable Apple Silicon generally (Peter Robinson) - cleanup Intel's FPGA configs (Peter Robinson) - common: move PTP KVM support from ark to common (Peter Robinson) - Enable CONFIG_DRM_AMDGPU_USERPTR for everyone (Justin M. Forbes) - redhat: add initial rpminspect configuration (Herton R. Krzesinski) - fedora: arm updates for 5.13 (Peter Robinson) - fedora: Enable WWAN and associated MHI bits (Peter Robinson) - Update CONFIG_MODPROBE_PATH to /usr/sbin (Justin Forbes) - Fedora set modprobe path (Justin M. Forbes) - Keep sctp and l2tp modules in modules-extra (Don Zickus) - Fix ppc64le cross build packaging (Don Zickus) - Fedora: Make amd_pinctrl module builtin (Hans de Goede) - Keep CONFIG_KASAN_HW_TAGS off for aarch64 debug configs (Justin M. Forbes) - New configs in drivers/bus (Fedora Kernel Team) - RHEL: Don't build KVM PR module on ppc64 (David Gibson) [1930649] - Flip CONFIG_USB_ROLE_SWITCH from m to y (Justin M. Forbes) - Set valid options for CONFIG_FW_LOADER_USER_HELPER (Justin M. Forbes) - Clean up CONFIG_FB_MODE_HELPERS (Justin M. Forbes) - Turn off CONFIG_VFIO for the s390x zfcpdump kernel (Justin M. Forbes) - Delete unused CONFIG_SND_SOC_MAX98390 pending-common (Justin M. Forbes) - Update pending-common configs, preparing to set correctly (Justin M. Forbes) - Update fedora filters for surface (Justin M. Forbes) - Build CONFIG_CRYPTO_ECDSA inline for s390x zfcpdump (Justin M. Forbes) - Replace "flavour" where "variant" is meant instead (David Ward) - Drop the %{variant} macro and fix --with-vanilla (David Ward) - Fix syntax of %kernel_variant_files (David Ward) - Change description of --without-vdso-install to fix typo (David Ward) - Config updates to work around mismatches (Justin M. Forbes) - CONFIG_SND_SOC_FSL_ASOC_CARD selects CONFIG_MFD_WM8994 now (Justin M. Forbes) - wireguard: disable in FIPS mode (Hangbin Liu) [1940794] - Enable mtdram for fedora (rhbz 1955916) (Justin M. Forbes) - Remove reference to bpf-helpers man page (Justin M. Forbes) - Fedora: enable more modules for surface devices (Dave Olsthoorn) - Fix Fedora config mismatch for CONFIG_FSL_ENETC_IERB (Justin M. Forbes) - hardlink is in /usr/bin/ now (Justin M. Forbes) - Ensure CONFIG_KVM_BOOK3S_64_PR stays on in Fedora, even if it is turned off in RHEL (Justin M. Forbes) - Set date in package release from repository commit, not system clock (David Ward) - Use a better upstream tarball filename for snapshots (David Ward) - Don't create empty pending-common files on pending-fedora commits (Don Zickus) - nvme: decouple basic ANA log page re-read support from native multipathing (Mike Snitzer) - nvme: allow local retry and proper failover for REQ_FAILFAST_TRANSPORT (Mike Snitzer) - nvme: Return BLK_STS_TARGET if the DNR bit is set (Mike Snitzer) - Add redhat/configs/pending-common/generic/s390x/zfcpdump/CONFIG_NETFS_SUPPORT (Justin M. Forbes) - Create ark-latest branch last for CI scripts (Don Zickus) - Replace /usr/libexec/platform-python with /usr/bin/python3 (David Ward) - Turn off ADI_AXI_ADC and AD9467 which now require CONFIG_OF (Justin M. Forbes) - Export ark infrastructure files (Don Zickus) - docs: Update docs to reflect newer workflow. (Don Zickus) - Use upstream/master for merge-base with fallback to master (Don Zickus) - Fedora: Turn off the SND_INTEL_BYT_PREFER_SOF option (Hans de Goede) - filter-modules.sh.fedora: clean up "netprots" (Paul Bolle) - filter-modules.sh.fedora: clean up "scsidrvs" (Paul Bolle) - filter-*.sh.fedora: clean up "ethdrvs" (Paul Bolle) - filter-*.sh.fedora: clean up "driverdirs" (Paul Bolle) - filter-*.sh.fedora: remove incorrect entries (Paul Bolle) - filter-*.sh.fedora: clean up "singlemods" (Paul Bolle) - filter-modules.sh.fedora: drop unused list "iiodrvs" (Paul Bolle) - Update mod-internal to fix depmod issue (Nico Pache) - Turn on CONFIG_VDPA_SIM_NET (rhbz 1942343) (Justin M. Forbes) - New configs in drivers/power (Fedora Kernel Team) - Turn on CONFIG_NOUVEAU_DEBUG_PUSH for debug configs (Justin M. Forbes) - Turn off KFENCE sampling by default for Fedora (Justin M. Forbes) - Fedora config updates round 2 (Justin M. Forbes) - New configs in drivers/soc (Jeremy Cline) - filter-modules.sh: Fix copy/paste error 'input' (Paul Bolle) - Update module filtering for 5.12 kernels (Justin M. Forbes) - Fix genlog.py to ensure that comments retain "%" characters. (Mark Mielke) - New configs in drivers/leds (Fedora Kernel Team) - Limit CONFIG_USB_CDNS_SUPPORT to x86_64 and arm in Fedora (David Ward) - Fedora: Enable CHARGER_GPIO on aarch64 too (Peter Robinson) - Fedora config updates (Justin M. Forbes) - configs: enable CONFIG_WIREGUARD in ARK (Hangbin Liu) [1613522] - Remove duplicate configs acroos fedora, ark and common (Don Zickus) - Combine duplicate configs across ark and fedora into common (Don Zickus) - common/ark: cleanup and unify the parport configs (Peter Robinson) - iommu/vt-d: enable INTEL_IDXD_SVM for both fedora and rhel (Jerry Snitselaar) - REDHAT: coresight: etm4x: Disable coresight on HPE Apollo 70 (Jeremy Linton) - configs/common/generic: disable CONFIG_SLAB_MERGE_DEFAULT (Rafael Aquini) - Remove _legacy_common_support (Justin M. Forbes) - redhat/mod-blacklist.sh: Fix floppy blacklisting (Hans de Goede) - New configs in fs/pstore (CKI@GitLab) - New configs in arch/powerpc (Fedora Kernel Team) - configs: enable BPF LSM on Fedora and ARK (Ondrej Mosnacek) - configs: clean up LSM configs (Ondrej Mosnacek) - New configs in drivers/platform (CKI@GitLab) - New configs in drivers/firmware (CKI@GitLab) - New configs in drivers/mailbox (Fedora Kernel Team) - New configs in drivers/net/phy (Justin M. Forbes) - Update CONFIG_DM_MULTIPATH_IOA (Augusto Caringi) - New configs in mm/Kconfig (CKI@GitLab) - New configs in arch/powerpc (Jeremy Cline) - New configs in arch/powerpc (Jeremy Cline) - New configs in drivers/input (Fedora Kernel Team) - New configs in net/bluetooth (Justin M. Forbes) - New configs in drivers/clk (Fedora Kernel Team) - New configs in init/Kconfig (Jeremy Cline) - redhat: allow running fedora-configs and rh-configs targets outside of redhat/ (Herton R. Krzesinski) - all: unify the disable of goldfish (android emulation platform) (Peter Robinson) - common: minor cleanup/de-dupe of dma/dmabuf debug configs (Peter Robinson) - common/ark: these drivers/arches were removed in 5.12 (Peter Robinson) - Correct kernel-devel make prepare build for 5.12. (Paulo E. Castro) - redhat: add initial support for centos stream dist-git sync on Makefiles (Herton R. Krzesinski) - redhat/configs: Enable CONFIG_SCHED_STACK_END_CHECK for Fedora and ARK (Josh Poimboeuf) [1856174] - CONFIG_VFIO now selects IOMMU_API instead of depending on it, causing several config mismatches for the zfcpdump kernel (Justin M. Forbes) - Turn off weak-modules for Fedora (Justin M. Forbes) - redhat: enable CONFIG_FW_LOADER_COMPRESS for ARK (Herton R. Krzesinski) [1939095] - Fedora: filters: update to move dfl-emif to modules (Peter Robinson) - drop duplicate DEVFREQ_GOV_SIMPLE_ONDEMAND config (Peter Robinson) - efi: The EFI_VARS is legacy and now x86 only (Peter Robinson) - common: enable RTC_SYSTOHC to supplement update_persistent_clock64 (Peter Robinson) - generic: arm: enable SCMI for all options (Peter Robinson) - fedora: the PCH_CAN driver is x86-32 only (Peter Robinson) - common: disable legacy CAN device support (Peter Robinson) - common: Enable Microchip MCP251x/MCP251xFD CAN controllers (Peter Robinson) - common: Bosch MCAN support for Intel Elkhart Lake (Peter Robinson) - common: enable CAN_PEAK_PCIEFD PCI-E driver (Peter Robinson) - common: disable CAN_PEAK_PCIEC PCAN-ExpressCard (Peter Robinson) - common: enable common CAN layer 2 protocols (Peter Robinson) - ark: disable CAN_LEDS option (Peter Robinson) - Fedora: Turn on SND_SOC_INTEL_SKYLAKE_HDAUDIO_CODEC option (Hans de Goede) - Fedora: enable modules for surface devices (Dave Olsthoorn) - Turn on SND_SOC_INTEL_SOUNDWIRE_SOF_MACH for Fedora again (Justin M. Forbes) - common: fix WM8804 codec dependencies (Peter Robinson) - Build SERIO_SERPORT as a module (Peter Robinson) - input: touchscreen: move ELO and Wacom serial touchscreens to x86 (Peter Robinson) - Sync serio touchscreens for non x86 architectures to the same as ARK (Peter Robinson) - Only enable SERIO_LIBPS2 on x86 (Peter Robinson) - Only enable PC keyboard controller and associated keyboard on x86 (Peter Robinson) - Generic: Mouse: Tweak generic serial mouse options (Peter Robinson) - Only enable PS2 Mouse options on x86 (Peter Robinson) - Disable bluetooth highspeed by default (Peter Robinson) - Fedora: A few more general updates for 5.12 window (Peter Robinson) - Fedora: Updates for 5.12 merge window (Peter Robinson) - Fedora: remove dead options that were removed upstream (Peter Robinson) - redhat: remove CONFIG_DRM_PANEL_XINGBANGDA_XBD599 (Herton R. Krzesinski) - New configs in arch/powerpc (Fedora Kernel Team) - Turn on CONFIG_PPC_QUEUED_SPINLOCKS as it is default upstream now (Justin M. Forbes) - Update pending-common configs to address new upstream config deps (Justin M. Forbes) - rpmspec: ship gpio-watch.debug in the proper debuginfo package (Herton R. Krzesinski) - Removed description text as a comment confuses the config generation (Justin M. Forbes) - New configs in drivers/dma-buf (Jeremy Cline) - Fedora: ARMv7: build for 16 CPUs. (Peter Robinson) - Fedora: only enable DEBUG_HIGHMEM on debug kernels (Peter Robinson) - process_configs.sh: fix find/xargs data flow (Ondrej Mosnacek) - Fedora config update (Justin M. Forbes) - fedora: minor arm sound config updates (Peter Robinson) - Fix trailing white space in redhat/configs/fedora/generic/CONFIG_SND_INTEL_BYT_PREFER_SOF (Justin M. Forbes) - Add a redhat/rebase-notes.txt file (Hans de Goede) - Turn on SND_INTEL_BYT_PREFER_SOF for Fedora (Hans de Goede) - CI: Drop MR ID from the name variable (Veronika Kabatova) - redhat: add DUP and kpatch certificates to system trusted keys for RHEL build (Herton R. Krzesinski) - The comments in CONFIG_USB_RTL8153_ECM actually turn off CONFIG_USB_RTL8152 (Justin M. Forbes) - Update CKI pipeline project (Veronika Kabatova) - Turn off additional KASAN options for Fedora (Justin M. Forbes) - Rename the master branch to rawhide for Fedora (Justin M. Forbes) - Makefile targets for packit integration (Ben Crocker) - Turn off KASAN for rawhide debug builds (Justin M. Forbes) - New configs in arch/arm64 (Justin Forbes) - Remove deprecated Intel MIC config options (Peter Robinson) - redhat: replace inline awk script with genlog.py call (Herton R. Krzesinski) - redhat: add genlog.py script (Herton R. Krzesinski) - kernel.spec.template - fix use_vdso usage (Ben Crocker) - redhat: remove remaining references of CONFIG_RH_DISABLE_DEPRECATED (Herton R. Krzesinski) - Turn off vdso_install for ppc (Justin M. Forbes) - Remove bpf-helpers.7 from bpftool package (Jiri Olsa) - New configs in lib/Kconfig.debug (Fedora Kernel Team) - Turn off CONFIG_VIRTIO_CONSOLE for s390x zfcpdump (Justin M. Forbes) - New configs in drivers/clk (Justin M. Forbes) - Keep VIRTIO_CONSOLE on s390x available. (Jakub Čajka) - New configs in lib/Kconfig.debug (Jeremy Cline) - Fedora 5.11 config updates part 4 (Justin M. Forbes) - Fedora 5.11 config updates part 3 (Justin M. Forbes) - Fedora 5.11 config updates part 2 (Justin M. Forbes) - Update internal (test) module list from RHEL-8 (Joe Lawrence) [1915073] - Fix USB_XHCI_PCI regression (Justin M. Forbes) - fedora: fixes for ARMv7 build issue by disabling HIGHPTE (Peter Robinson) - all: s390x: Increase CONFIG_PCI_NR_FUNCTIONS to 512 (#1888735) (Dan Horák) - Fedora 5.11 configs pt 1 (Justin M. Forbes) - redhat: avoid conflict with mod-blacklist.sh and released_kernel defined (Herton R. Krzesinski) - redhat: handle certificate files conditionally as done for src.rpm (Herton R. Krzesinski) - specfile: add %{?_smp_mflags} to "make headers_install" in tools/testing/selftests (Denys Vlasenko) - specfile: add %{?_smp_mflags} to "make samples/bpf/" (Denys Vlasenko) - Run MR testing in CKI pipeline (Veronika Kabatova) - Reword comment (Nicolas Chauvet) - Add with_cross_arm conditional (Nicolas Chauvet) - Redefines __strip if with_cross (Nicolas Chauvet) - fedora: only enable ACPI_CONFIGFS, ACPI_CUSTOM_METHOD in debug kernels (Peter Robinson) - fedora: User the same EFI_CUSTOM_SSDT_OVERLAYS as ARK (Peter Robinson) - all: all arches/kernels enable the same DMI options (Peter Robinson) - all: move SENSORS_ACPI_POWER to common/generic (Peter Robinson) - fedora: PCIE_HISI_ERR is already in common (Peter Robinson) - all: all ACPI platforms enable ATA_ACPI so move it to common (Peter Robinson) - all: x86: move shared x86 acpi config options to generic (Peter Robinson) - All: x86: Move ACPI_VIDEO to common/x86 (Peter Robinson) - All: x86: Enable ACPI_DPTF (Intel DPTF) (Peter Robinson) - All: enable ACPI_BGRT for all ACPI platforms. (Peter Robinson) - All: Only build ACPI_EC_DEBUGFS for debug kernels (Peter Robinson) - All: Disable Intel Classmate PC ACPI_CMPC option (Peter Robinson) - cleanup: ACPI_PROCFS_POWER was removed upstream (Peter Robinson) - All: ACPI: De-dupe the ACPI options that are the same across ark/fedora on x86/arm (Peter Robinson) - Enable the vkms module in Fedora (Jeremy Cline) - Fedora: arm updates for 5.11 and general cross Fedora cleanups (Peter Robinson) - Add gcc-c++ to BuildRequires (Justin M. Forbes) - Update CONFIG_KASAN_HW_TAGS (Justin M. Forbes) - fedora: arm: move generic power off/reset to all arm (Peter Robinson) - fedora: ARMv7: build in DEVFREQ_GOV_SIMPLE_ONDEMAND until I work out why it's changed (Peter Robinson) - fedora: cleanup joystick_adc (Peter Robinson) - fedora: update some display options (Peter Robinson) - fedora: arm: enable TI PRU options (Peter Robinson) - fedora: arm: minor exynos plaform updates (Peter Robinson) - arm: SoC: disable Toshiba Visconti SoC (Peter Robinson) - common: disable ARCH_BCM4908 (NFC) (Peter Robinson) - fedora: minor arm config updates (Peter Robinson) - fedora: enable Tegra 234 SoC (Peter Robinson) - fedora: arm: enable new Hikey 3xx options (Peter Robinson) - Fedora: USB updates (Peter Robinson) - fedora: enable the GNSS receiver subsystem (Peter Robinson) - Remove POWER_AVS as no longer upstream (Peter Robinson) - Cleanup RESET_RASPBERRYPI (Peter Robinson) - Cleanup GPIO_CDEV_V1 options. (Peter Robinson) - fedora: arm crypto updates (Peter Robinson) - CONFIG_KASAN_HW_TAGS for aarch64 (Justin M. Forbes) - Fedora: cleanup PCMCIA configs, move to x86 (Peter Robinson) - New configs in drivers/rtc (Fedora Kernel Team) - redhat/configs: Enable CONFIG_GCC_PLUGIN_STRUCTLEAK_BYREF_ALL (Josh Poimboeuf) [1856176] - redhat/configs: Enable CONFIG_GCC_PLUGIN_STRUCTLEAK (Josh Poimboeuf) [1856176] - redhat/configs: Enable CONFIG_GCC_PLUGINS on ARK (Josh Poimboeuf) [1856176] - redhat/configs: Enable CONFIG_KASAN on Fedora (Josh Poimboeuf) [1856176] - New configs in init/Kconfig (Fedora Kernel Team) - build_configs.sh: Fix syntax flagged by shellcheck (Ben Crocker) - genspec.sh: Fix syntax flagged by shellcheck (Ben Crocker) - mod-blacklist.sh: Fix syntax flagged by shellcheck (Ben Crocker) - Enable Speakup accessibility driver (Justin M. Forbes) - New configs in init/Kconfig (Fedora Kernel Team) - Fix fedora config mismatch due to dep changes (Justin M. Forbes) - New configs in drivers/crypto (Jeremy Cline) - Remove duplicate ENERGY_MODEL configs (Peter Robinson) - This is selected by PCIE_QCOM so must match (Justin M. Forbes) - drop unused BACKLIGHT_GENERIC (Peter Robinson) - Remove cp instruction already handled in instruction below. (Paulo E. Castro) - Add all the dependencies gleaned from running `make prepare` on a bloated devel kernel. (Paulo E. Castro) - Add tools to path mangling script. (Paulo E. Castro) - Remove duplicate cp statement which is also not specific to x86. (Paulo E. Castro) - Correct orc_types failure whilst running `make prepare` https://bugzilla.redhat.com/show_bug.cgi?id=1882854 (Paulo E. Castro) - redhat: ark: enable CONFIG_IKHEADERS (Jiri Olsa) - Add missing '$' sign to (GIT) in redhat/Makefile (Augusto Caringi) - Remove filterdiff and use native git instead (Don Zickus) - New configs in net/sched (Justin M. Forbes) - New configs in drivers/mfd (CKI@GitLab) - New configs in drivers/mfd (Fedora Kernel Team) - New configs in drivers/firmware (Fedora Kernel Team) - Temporarily backout parallel xz script (Justin M. Forbes) - redhat: explicitly disable CONFIG_IMA_APPRAISE_SIGNED_INIT (Bruno Meneguele) - redhat: enable CONFIG_EVM_LOAD_X509 on ARK (Bruno Meneguele) - redhat: enable CONFIG_EVM_ATTR_FSUUID on ARK (Bruno Meneguele) - redhat: enable CONFIG_EVM in all arches and flavors (Bruno Meneguele) - redhat: enable CONFIG_IMA_LOAD_X509 on ARK (Bruno Meneguele) - redhat: set CONFIG_IMA_DEFAULT_HASH to SHA256 (Bruno Meneguele) - redhat: enable CONFIG_IMA_SECURE_AND_OR_TRUSTED_BOOT (Bruno Meneguele) - redhat: enable CONFIG_IMA_READ_POLICY on ARK (Bruno Meneguele) - redhat: set default IMA template for all ARK arches (Bruno Meneguele) - redhat: enable CONFIG_IMA_DEFAULT_HASH_SHA256 for all flavors (Bruno Meneguele) - redhat: disable CONFIG_IMA_DEFAULT_HASH_SHA1 (Bruno Meneguele) - redhat: enable CONFIG_IMA_ARCH_POLICY for ppc and x86 (Bruno Meneguele) - redhat: enable CONFIG_IMA_APPRAISE_MODSIG (Bruno Meneguele) - redhat: enable CONFIG_IMA_APPRAISE_BOOTPARAM (Bruno Meneguele) - redhat: enable CONFIG_IMA_APPRAISE (Bruno Meneguele) - redhat: enable CONFIG_INTEGRITY for aarch64 (Bruno Meneguele) - kernel: Update some missing KASAN/KCSAN options (Jeremy Linton) - kernel: Enable coresight on aarch64 (Jeremy Linton) - Update CONFIG_INET6_ESPINTCP (Justin Forbes) - New configs in net/ipv6 (Justin M. Forbes) - fedora: move CONFIG_RTC_NVMEM options from ark to common (Peter Robinson) - configs: Enable CONFIG_DEBUG_INFO_BTF (Don Zickus) - fedora: some minor arm audio config tweaks (Peter Robinson) - Ship xpad with default modules on Fedora and RHEL (Bastien Nocera) - Fedora: Only enable legacy serial/game port joysticks on x86 (Peter Robinson) - Fedora: Enable the options required for the Librem 5 Phone (Peter Robinson) - Fedora config update (Justin M. Forbes) - Fedora config change because CONFIG_FSL_DPAA2_ETH now selects CONFIG_FSL_XGMAC_MDIO (Justin M. Forbes) - redhat: generic enable CONFIG_INET_MPTCP_DIAG (Davide Caratti) - Fedora config update (Justin M. Forbes) - Enable NANDSIM for Fedora (Justin M. Forbes) - Re-enable CONFIG_ACPI_TABLE_UPGRADE for Fedora since upstream disables this if secureboot is active (Justin M. Forbes) - Ath11k related config updates (Justin M. Forbes) - Fedora config updates for ath11k (Justin M. Forbes) - Turn on ATH11K for Fedora (Justin M. Forbes) - redhat: enable CONFIG_INTEL_IOMMU_SVM (Jerry Snitselaar) - More Fedora config fixes (Justin M. Forbes) - Fedora 5.10 config updates (Justin M. Forbes) - Fedora 5.10 configs round 1 (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Allow kernel-tools to build without selftests (Don Zickus) - Allow building of kernel-tools standalone (Don Zickus) - redhat: ark: disable CONFIG_NET_ACT_CTINFO (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_TEQL (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_SFB (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_QFQ (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_PLUG (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_PIE (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_HHF (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_DSMARK (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_DRR (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_CODEL (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_CHOKE (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_CBQ (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_ATM (Davide Caratti) - redhat: ark: disable CONFIG_NET_EMATCH and sub-targets (Davide Caratti) - redhat: ark: disable CONFIG_NET_CLS_TCINDEX (Davide Caratti) - redhat: ark: disable CONFIG_NET_CLS_RSVP6 (Davide Caratti) - redhat: ark: disable CONFIG_NET_CLS_RSVP (Davide Caratti) - redhat: ark: disable CONFIG_NET_CLS_ROUTE4 (Davide Caratti) - redhat: ark: disable CONFIG_NET_CLS_BASIC (Davide Caratti) - redhat: ark: disable CONFIG_NET_ACT_SKBMOD (Davide Caratti) - redhat: ark: disable CONFIG_NET_ACT_SIMP (Davide Caratti) - redhat: ark: disable CONFIG_NET_ACT_NAT (Davide Caratti) - arm64/defconfig: Enable CONFIG_KEXEC_FILE (Bhupesh Sharma) [1821565] - redhat/configs: Cleanup CONFIG_CRYPTO_SHA512 (Prarit Bhargava) - New configs in drivers/mfd (Fedora Kernel Team) - Fix LTO issues with kernel-tools (Don Zickus) - Point pathfix to the new location for gen_compile_commands.py (Justin M. Forbes) - configs: Disable CONFIG_SECURITY_SELINUX_DISABLE (Ondrej Mosnacek) - [Automatic] Handle config dependency changes (Don Zickus) - configs/iommu: Add config comment to empty CONFIG_SUN50I_IOMMU file (Jerry Snitselaar) - New configs in kernel/trace (Fedora Kernel Team) - Fix Fedora config locations (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - configs: enable CONFIG_CRYPTO_CTS=y so cts(cbc(aes)) is available in FIPS mode (Vladis Dronov) [1855161] - Partial revert: Add master merge check (Don Zickus) - Update Maintainers doc to reflect workflow changes (Don Zickus) - WIP: redhat/docs: Update documentation for single branch workflow (Prarit Bhargava) - Add CONFIG_ARM64_MTE which is not picked up by the config scripts for some reason (Justin M. Forbes) - Disable Speakup synth DECEXT (Justin M. Forbes) - Enable Speakup for Fedora since it is out of staging (Justin M. Forbes) - Modify patchlist changelog output (Don Zickus) - process_configs.sh: Fix syntax flagged by shellcheck (Ben Crocker) - generate_all_configs.sh: Fix syntax flagged by shellcheck (Ben Crocker) - redhat/self-test: Initial commit (Ben Crocker) - arch/x86: Remove vendor specific CPU ID checks (Prarit Bhargava) - redhat: Replace hardware.redhat.com link in Unsupported message (Prarit Bhargava) [1810301] - x86: Fix compile issues with rh_check_supported() (Don Zickus) - KEYS: Make use of platform keyring for module signature verify (Robert Holmes) - Input: rmi4 - remove the need for artificial IRQ in case of HID (Benjamin Tissoires) - ARM: tegra: usb no reset (Peter Robinson) - arm: make CONFIG_HIGHPTE optional without CONFIG_EXPERT (Jon Masters) - redhat: rh_kabi: deduplication friendly structs (Jiri Benc) - redhat: rh_kabi add a comment with warning about RH_KABI_EXCLUDE usage (Jiri Benc) - redhat: rh_kabi: introduce RH_KABI_EXTEND_WITH_SIZE (Jiri Benc) - redhat: rh_kabi: Indirect EXTEND macros so nesting of other macros will resolve. (Don Dutile) - redhat: rh_kabi: Fix RH_KABI_SET_SIZE to use dereference operator (Tony Camuso) - redhat: rh_kabi: Add macros to size and extend structs (Prarit Bhargava) - Removing Obsolete hba pci-ids from rhel8 (Dick Kennedy) [1572321] - mptsas: pci-id table changes (Laura Abbott) - mptsas: Taint kernel if mptsas is loaded (Laura Abbott) - mptspi: pci-id table changes (Laura Abbott) - qla2xxx: Remove PCI IDs of deprecated adapter (Jeremy Cline) - be2iscsi: remove unsupported device IDs (Chris Leech) [1574502 1598366] - mptspi: Taint kernel if mptspi is loaded (Laura Abbott) - hpsa: remove old cciss-based smartarray pci ids (Joseph Szczypek) [1471185] - qla4xxx: Remove deprecated PCI IDs from RHEL 8 (Chad Dupuis) [1518874] - aacraid: Remove depreciated device and vendor PCI id's (Raghava Aditya Renukunta) [1495307] - megaraid_sas: remove deprecated pci-ids (Tomas Henzl) [1509329] - mpt*: remove certain deprecated pci-ids (Jeremy Cline) - kernel: add SUPPORT_REMOVED kernel taint (Tomas Henzl) [1602033] - Rename RH_DISABLE_DEPRECATED to RHEL_DIFFERENCES (Don Zickus) - s390: Lock down the kernel when the IPL secure flag is set (Jeremy Cline) - efi: Lock down the kernel if booted in secure boot mode (David Howells) - efi: Add an EFI_SECURE_BOOT flag to indicate secure boot mode (David Howells) - security: lockdown: expose a hook to lock the kernel down (Jeremy Cline) - Make get_cert_list() use efi_status_to_str() to print error messages. (Peter Jones) - Add efi_status_to_str() and rework efi_status_to_err(). (Peter Jones) - Add support for deprecating processors (Laura Abbott) [1565717 1595918 1609604 1610493] - arm: aarch64: Drop the EXPERT setting from ARM64_FORCE_52BIT (Jeremy Cline) - iommu/arm-smmu: workaround DMA mode issues (Laura Abbott) - rh_kabi: introduce RH_KABI_EXCLUDE (Jakub Racek) [1652256] - ipmi: do not configure ipmi for HPE m400 (Laura Abbott) [1670017] - kABI: Add generic kABI macros to use for kABI workarounds (Myron Stowe) [1546831] - add pci_hw_vendor_status() (Maurizio Lombardi) [1590829] - ahci: thunderx2: Fix for errata that affects stop engine (Robert Richter) [1563590] - Vulcan: AHCI PCI bar fix for Broadcom Vulcan early silicon (Robert Richter) [1563590] - bpf: set unprivileged_bpf_disabled to 1 by default, add a boot parameter (Eugene Syromiatnikov) [1561171] - add Red Hat-specific taint flags (Eugene Syromiatnikov) [1559877] - tags.sh: Ignore redhat/rpm (Jeremy Cline) - put RHEL info into generated headers (Laura Abbott) [1663728] - aarch64: acpi scan: Fix regression related to X-Gene UARTs (Mark Salter) [1519554] - ACPI / irq: Workaround firmware issue on X-Gene based m400 (Mark Salter) [1519554] - modules: add rhelversion MODULE_INFO tag (Laura Abbott) - ACPI: APEI: arm64: Ignore broken HPE moonshot APEI support (Al Stone) [1518076] - Add Red Hat tainting (Laura Abbott) [1565704 1652266] - Introduce CONFIG_RH_DISABLE_DEPRECATED (Laura Abbott) - Stop merging ark-patches for release (Don Zickus) - Fix path location for ark-update-configs.sh (Don Zickus) - Combine Red Hat patches into single patch (Don Zickus) - New configs in drivers/misc (Jeremy Cline) - New configs in drivers/net/wireless (Justin M. Forbes) - New configs in drivers/phy (Fedora Kernel Team) - New configs in drivers/tty (Fedora Kernel Team) - Set SquashFS decompression options for all flavors to match RHEL (Bohdan Khomutskyi) - configs: Enable CONFIG_ENERGY_MODEL (Phil Auld) - New configs in drivers/pinctrl (Fedora Kernel Team) - Update CONFIG_THERMAL_NETLINK (Justin Forbes) - Separate merge-upstream and release stages (Don Zickus) - Re-enable CONFIG_IR_SERIAL on Fedora (Prarit Bhargava) - Create Patchlist.changelog file (Don Zickus) - Filter out upstream commits from changelog (Don Zickus) - Merge Upstream script fixes (Don Zickus) - kernel.spec: Remove kernel-keys directory on rpm erase (Prarit Bhargava) - Add mlx5_vdpa to module filter for Fedora (Justin M. Forbes) - Add python3-sphinx_rtd_theme buildreq for docs (Justin M. Forbes) - redhat/configs/process_configs.sh: Remove *.config.orig files (Prarit Bhargava) - redhat/configs/process_configs.sh: Add process_configs_known_broken flag (Prarit Bhargava) - redhat/Makefile: Fix '*-configs' targets (Prarit Bhargava) - dist-merge-upstream: Checkout known branch for ci scripts (Don Zickus) - kernel.spec: don't override upstream compiler flags for ppc64le (Dan Horák) - Fedora config updates (Justin M. Forbes) - Fedora confi gupdate (Justin M. Forbes) - mod-sign.sh: Fix syntax flagged by shellcheck (Ben Crocker) - Swap how ark-latest is built (Don Zickus) - Add extra version bump to os-build branch (Don Zickus) - dist-release: Avoid needless version bump. (Don Zickus) - Add dist-fedora-release target (Don Zickus) - Remove redundant code in dist-release (Don Zickus) - Makefile.common rename TAG to _TAG (Don Zickus) - Fedora config change (Justin M. Forbes) - Fedora filter update (Justin M. Forbes) - Config update for Fedora (Justin M. Forbes) - enable PROTECTED_VIRTUALIZATION_GUEST for all s390x kernels (Dan Horák) - redhat: ark: enable CONFIG_NET_SCH_TAPRIO (Davide Caratti) - redhat: ark: enable CONFIG_NET_SCH_ETF (Davide Caratti) - More Fedora config updates (Justin M. Forbes) - New config deps (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - First half of config updates for Fedora (Justin M. Forbes) - Updates for Fedora arm architectures for the 5.9 window (Peter Robinson) - Merge 5.9 config changes from Peter Robinson (Justin M. Forbes) - Add config options that only show up when we prep on arm (Justin M. Forbes) - Config updates for Fedora (Justin M. Forbes) - fedora: enable enery model (Peter Robinson) - Use the configs/generic config for SND_HDA_INTEL everywhere (Peter Robinson) - Enable ZSTD compression algorithm on all kernels (Peter Robinson) - Enable ARM_SMCCC_SOC_ID on all aarch64 kernels (Peter Robinson) - iio: enable LTR-559 light and proximity sensor (Peter Robinson) - iio: chemical: enable some popular chemical and partical sensors (Peter Robinson) - More mismatches (Justin M. Forbes) - Fedora config change due to deps (Justin M. Forbes) - CONFIG_SND_SOC_MAX98390 is now selected by SND_SOC_INTEL_DA7219_MAX98357A_GENERIC (Justin M. Forbes) - Config change required for build part 2 (Justin M. Forbes) - Config change required for build (Justin M. Forbes) - Fedora config update (Justin M. Forbes) - Add ability to sync upstream through Makefile (Don Zickus) - Add master merge check (Don Zickus) - Replace hardcoded values 'os-build' and project id with variables (Don Zickus) - redhat/Makefile.common: Fix MARKER (Prarit Bhargava) - gitattributes: Remove unnecesary export restrictions (Prarit Bhargava) - Add new certs for dual signing with boothole (Justin M. Forbes) - Update secureboot signing for dual keys (Justin M. Forbes) - fedora: enable LEDS_SGM3140 for arm configs (Peter Robinson) - Enable CONFIG_DM_VERITY_VERIFY_ROOTHASH_SIG (Justin M. Forbes) - redhat/configs: Fix common CONFIGs (Prarit Bhargava) - redhat/configs: General CONFIG cleanups (Prarit Bhargava) - redhat/configs: Update & generalize evaluate_configs (Prarit Bhargava) - fedora: arm: Update some meson config options (Peter Robinson) - redhat/docs: Add Fedora RPM tagging date (Prarit Bhargava) - Update config for renamed panel driver. (Peter Robinson) - Enable SERIAL_SC16IS7XX for SPI interfaces (Peter Robinson) - s390x-zfcpdump: Handle missing Module.symvers file (Don Zickus) - Fedora config updates (Justin M. Forbes) - redhat/configs: Add .tmp files to .gitignore (Prarit Bhargava) - disable uncommon TCP congestion control algorithms (Davide Caratti) - Add new bpf man pages (Justin M. Forbes) - Add default option for CONFIG_ARM64_BTI_KERNEL to pending-common so that eln kernels build (Justin M. Forbes) - redhat/Makefile: Add fedora-configs and rh-configs make targets (Prarit Bhargava) - redhat/configs: Use SHA512 for module signing (Prarit Bhargava) - genspec.sh: 'touch' empty Patchlist file for single tarball (Don Zickus) - Fedora config update for rc1 (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - redhat/Makefile.common: fix RPMKSUBLEVEL condition (Ondrej Mosnacek) - redhat/Makefile: silence KABI tar output (Ondrej Mosnacek) - One more Fedora config update (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fix PATCHLEVEL for merge window (Justin M. Forbes) - Change ark CONFIG_COMMON_CLK to yes, it is selected already by other options (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - More module filtering for Fedora (Justin M. Forbes) - Update filters for rnbd in Fedora (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fix up module filtering for 5.8 (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - More Fedora config work (Justin M. Forbes) - RTW88BE and CE have been extracted to their own modules (Justin M. Forbes) - Set CONFIG_BLK_INLINE_ENCRYPTION_FALLBACK for Fedora (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Arm64 Use Branch Target Identification for kernel (Justin M. Forbes) - Change value of CONFIG_SECURITY_SELINUX_CHECKREQPROT_VALUE (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fix configs for Fedora (Justin M. Forbes) - Add zero-commit to format-patch options (Justin M. Forbes) - Copy Makefile.rhelver as a source file rather than a patch (Jeremy Cline) - Move the sed to clear the patch templating outside of conditionals (Justin M. Forbes) - Match template format in kernel.spec.template (Justin M. Forbes) - Break out the Patches into individual files for dist-git (Justin M. Forbes) - Break the Red Hat patch into individual commits (Jeremy Cline) - Fix update_scripts.sh unselective pattern sub (David Howells) - Add cec to the filter overrides (Justin M. Forbes) - Add overrides to filter-modules.sh (Justin M. Forbes) - redhat/configs: Enable CONFIG_SMC91X and disable CONFIG_SMC911X (Prarit Bhargava) [1722136] - Include bpftool-struct_ops man page in the bpftool package (Jeremy Cline) - Add sharedbuffer_configuration.py to the pathfix.py script (Jeremy Cline) - Use __make macro instead of make (Tom Stellard) - Sign off generated configuration patches (Jeremy Cline) - Drop the static path configuration for the Sphinx docs (Jeremy Cline) - redhat: Add dummy-module kernel module (Prarit Bhargava) - redhat: enable CONFIG_LWTUNNEL_BPF (Jiri Benc) - Remove typoed config file aarch64CONFIG_SM_GCC_8150 (Justin M. Forbes) - Add Documentation back to kernel-devel as it has Kconfig now (Justin M. Forbes) - Copy distro files rather than moving them (Jeremy Cline) - kernel.spec: fix 'make scripts' for kernel-devel package (Brian Masney) - Makefile: correct help text for dist-cross--rpms (Brian Masney) - redhat/Makefile: Fix RHEL8 python warning (Prarit Bhargava) - redhat: Change Makefile target names to dist- (Prarit Bhargava) - configs: Disable Serial IR driver (Prarit Bhargava) - Fix "multiple %files for package kernel-tools" (Pablo Greco) - Introduce a Sphinx documentation project (Jeremy Cline) - Build ARK against ELN (Don Zickus) - Drop the requirement to have a remote called linus (Jeremy Cline) - Rename 'internal' branch to 'os-build' (Don Zickus) - Only include open merge requests with "Include in Releases" label (Jeremy Cline) - Package gpio-watch in kernel-tools (Jeremy Cline) - Exit non-zero if the tag already exists for a release (Jeremy Cline) - Adjust the changelog update script to not push anything (Jeremy Cline) - Drop --target noarch from the rh-rpms make target (Jeremy Cline) - Add a script to generate release tags and branches (Jeremy Cline) - Set CONFIG_VDPA for fedora (Justin M. Forbes) - Add a README to the dist-git repository (Jeremy Cline) - Provide defaults in ark-rebase-patches.sh (Jeremy Cline) - Default ark-rebase-patches.sh to not report issues (Jeremy Cline) - Drop DIST from release commits and tags (Jeremy Cline) - Place the buildid before the dist in the release (Jeremy Cline) - Sync up with Fedora arm configuration prior to merging (Jeremy Cline) - Disable CONFIG_PROTECTED_VIRTUALIZATION_GUEST for zfcpdump (Jeremy Cline) - Add RHMAINTAINERS file and supporting conf (Don Zickus) - Add a script to test if all commits are signed off (Jeremy Cline) - Fix make rh-configs-arch (Don Zickus) - Drop RH_FEDORA in favor of the now-merged RHEL_DIFFERENCES (Jeremy Cline) - Sync up Fedora configs from the first week of the merge window (Jeremy Cline) - Migrate blacklisting floppy.ko to mod-blacklist.sh (Don Zickus) - kernel packaging: Combine mod-blacklist.sh and mod-extra-blacklist.sh (Don Zickus) - kernel packaging: Fix extra namespace collision (Don Zickus) - mod-extra.sh: Rename to mod-blacklist.sh (Don Zickus) - mod-extra.sh: Make file generic (Don Zickus) - Fix a painfully obvious YAML syntax error in .gitlab-ci.yml (Jeremy Cline) - Add in armv7hl kernel header support (Don Zickus) - Disable all BuildKernel commands when only building headers (Don Zickus) - Drop any gitlab-ci patches from ark-patches (Jeremy Cline) - Build the srpm for internal branch CI using the vanilla tree (Jeremy Cline) - Pull in the latest ARM configurations for Fedora (Jeremy Cline) - Fix xz memory usage issue (Neil Horman) - Use ark-latest instead of master for update script (Jeremy Cline) - Move the CI jobs back into the ARK repository (Jeremy Cline) - Sync up ARK's Fedora config with the dist-git repository (Jeremy Cline) - Pull in the latest configuration changes from Fedora (Jeremy Cline) - configs: enable CONFIG_NET_SCH_CBS (Marcelo Ricardo Leitner) - Drop configuration options in fedora/ that no longer exist (Jeremy Cline) - Set RH_FEDORA for ARK and Fedora (Jeremy Cline) - redhat/kernel.spec: Include the release in the kernel COPYING file (Jeremy Cline) - redhat/kernel.spec: add scripts/jobserver-exec to py3_shbang_opts list (Jeremy Cline) - redhat/kernel.spec: package bpftool-gen man page (Jeremy Cline) - distgit-changelog: handle multiple y-stream BZ numbers (Bruno Meneguele) - redhat/kernel.spec: remove all inline comments (Bruno Meneguele) - redhat/genspec: awk unknown whitespace regex pattern (Bruno Meneguele) - Improve the readability of gen_config_patches.sh (Jeremy Cline) - Fix some awkward edge cases in gen_config_patches.sh (Jeremy Cline) - Update the CI environment to use Fedora 31 (Jeremy Cline) - redhat: drop whitespace from with_gcov macro (Jan Stancek) - configs: Enable CONFIG_KEY_DH_OPERATIONS on ARK (Ondrej Mosnacek) - configs: Adjust CONFIG_MPLS_ROUTING and CONFIG_MPLS_IPTUNNEL (Laura Abbott) - New configs in lib/crypto (Jeremy Cline) - New configs in drivers/char (Jeremy Cline) - Turn on BLAKE2B for Fedora (Jeremy Cline) - kernel.spec.template: Clean up stray *.h.s files (Laura Abbott) - Build the SRPM in the CI job (Jeremy Cline) - New configs in net/tls (Jeremy Cline) - New configs in net/tipc (Jeremy Cline) - New configs in lib/kunit (Jeremy Cline) - Fix up released_kernel case (Laura Abbott) - New configs in lib/Kconfig.debug (Jeremy Cline) - New configs in drivers/ptp (Jeremy Cline) - New configs in drivers/nvme (Jeremy Cline) - New configs in drivers/net/phy (Jeremy Cline) - New configs in arch/arm64 (Jeremy Cline) - New configs in drivers/crypto (Jeremy Cline) - New configs in crypto/Kconfig (Jeremy Cline) - Add label so the Gitlab to email bridge ignores the changelog (Jeremy Cline) - Temporarily switch TUNE_DEFAULT to y (Jeremy Cline) - Run config test for merge requests and internal (Jeremy Cline) - Add missing licensedir line (Laura Abbott) - redhat/scripts: Remove redhat/scripts/rh_get_maintainer.pl (Prarit Bhargava) - configs: Take CONFIG_DEFAULT_MMAP_MIN_ADDR from Fedra (Laura Abbott) - configs: Turn off ISDN (Laura Abbott) - Add a script to generate configuration patches (Laura Abbott) - Introduce rh-configs-commit (Laura Abbott) - kernel-packaging: Remove kernel files from kernel-modules-extra package (Prarit Bhargava) - configs: Enable CONFIG_DEBUG_WX (Laura Abbott) - configs: Disable wireless USB (Laura Abbott) - Clean up some temporary config files (Laura Abbott) - configs: New config in drivers/gpu for v5.4-rc1 (Jeremy Cline) - configs: New config in arch/powerpc for v5.4-rc1 (Jeremy Cline) - configs: New config in crypto for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/usb for v5.4-rc1 (Jeremy Cline) - AUTOMATIC: New configs (Jeremy Cline) - Skip ksamples for bpf, they are broken (Jeremy Cline) - configs: New config in fs/erofs for v5.4-rc1 (Jeremy Cline) - configs: New config in mm for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/md for v5.4-rc1 (Jeremy Cline) - configs: New config in init for v5.4-rc1 (Jeremy Cline) - configs: New config in fs/fuse for v5.4-rc1 (Jeremy Cline) - merge.pl: Avoid comments but do not skip them (Don Zickus) - configs: New config in drivers/net/ethernet/pensando for v5.4-rc1 (Jeremy Cline) - Update a comment about what released kernel means (Laura Abbott) - Provide both Fedora and RHEL files in the SRPM (Laura Abbott) - kernel.spec.template: Trim EXTRAVERSION in the Makefile (Laura Abbott) - kernel.spec.template: Add macros for building with nopatches (Laura Abbott) - kernel.spec.template: Add some macros for Fedora differences (Laura Abbott) - kernel.spec.template: Consolodate the options (Laura Abbott) - configs: Add pending direcory to Fedora (Laura Abbott) - kernel.spec.template: Don't run hardlink if rpm-ostree is in use (Laura Abbott) - configs: New config in net/can for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/net/phy for v5.4-rc1 (Jeremy Cline) - configs: Increase x86_64 NR_UARTS to 64 (Prarit Bhargava) [1730649] - configs: turn on ARM64_FORCE_52BIT for debug builds (Jeremy Cline) - kernel.spec.template: Tweak the python3 mangling (Laura Abbott) - kernel.spec.template: Add --with verbose option (Laura Abbott) - kernel.spec.template: Switch to using %install instead of %__install (Laura Abbott) - kernel.spec.template: Make the kernel.org URL https (Laura Abbott) - kernel.spec.template: Update message about secure boot signing (Laura Abbott) - kernel.spec.template: Move some with flags definitions up (Laura Abbott) - kernel.spec.template: Update some BuildRequires (Laura Abbott) - kernel.spec.template: Get rid of %clean (Laura Abbott) - configs: New config in drivers/char for v5.4-rc1 (Jeremy Cline) - configs: New config in net/sched for v5.4-rc1 (Jeremy Cline) - configs: New config in lib for v5.4-rc1 (Jeremy Cline) - configs: New config in fs/verity for v5.4-rc1 (Jeremy Cline) - configs: New config in arch/aarch64 for v5.4-rc4 (Jeremy Cline) - configs: New config in arch/arm64 for v5.4-rc1 (Jeremy Cline) - Flip off CONFIG_ARM64_VA_BITS_52 so the bundle that turns it on applies (Jeremy Cline) - New configuration options for v5.4-rc4 (Jeremy Cline) - Correctly name tarball for single tarball builds (Laura Abbott) - configs: New config in drivers/pci for v5.4-rc1 (Jeremy Cline) - Allow overriding the dist tag on the command line (Laura Abbott) - Allow scratch branch target to be overridden (Laura Abbott) - Remove long dead BUILD_DEFAULT_TARGET (Laura Abbott) - Amend the changelog when rebasing (Laura Abbott) - configs: New config in drivers/platform for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/pinctrl for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/net/wireless for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/net/ethernet/mellanox for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/net/can for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/hid for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/dma-buf for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/crypto for v5.4-rc1 (Jeremy Cline) - configs: New config in arch/s390 for v5.4-rc1 (Jeremy Cline) - configs: New config in block for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/cpuidle for v5.4-rc1 (Jeremy Cline) - redhat: configs: Split CONFIG_CRYPTO_SHA512 (Laura Abbott) - redhat: Set Fedora options (Laura Abbott) - Set CRYPTO_SHA3_*_S390 to builtin on zfcpdump (Jeremy Cline) - configs: New config in drivers/edac for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/firmware for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/hwmon for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/iio for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/mmc for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/tty for v5.4-rc1 (Jeremy Cline) - configs: New config in arch/s390 for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/bus for v5.4-rc1 (Jeremy Cline) - Add option to allow mismatched configs on the command line (Laura Abbott) - configs: New config in drivers/crypto for v5.4-rc1 (Jeremy Cline) - configs: New config in sound/pci for v5.4-rc1 (Jeremy Cline) - configs: New config in sound/soc for v5.4-rc1 (Jeremy Cline) - gitlab: Add CI job for packaging scripts (Major Hayden) - Speed up CI with CKI image (Major Hayden) - Disable e1000 driver in ARK (Neil Horman) - configs: Fix the pending default for CONFIG_ARM64_VA_BITS_52 (Jeremy Cline) - configs: Turn on OPTIMIZE_INLINING for everything (Jeremy Cline) - configs: Set valid pending defaults for CRYPTO_ESSIV (Jeremy Cline) - Add an initial CI configuration for the internal branch (Jeremy Cline) - New drop of configuration options for v5.4-rc1 (Jeremy Cline) - New drop of configuration options for v5.4-rc1 (Jeremy Cline) - Pull the RHEL version defines out of the Makefile (Jeremy Cline) - Sync up the ARK build scripts (Jeremy Cline) - Sync up the Fedora Rawhide configs (Jeremy Cline) - Sync up the ARK config files (Jeremy Cline) - configs: Adjust CONFIG_FORCE_MAX_ZONEORDER for Fedora (Laura Abbott) - configs: Add README for some other arches (Laura Abbott) - configs: Sync up Fedora configs (Laura Abbott) - [initial commit] Add structure for building with git (Laura Abbott) - [initial commit] Add Red Hat variables in the top level makefile (Laura Abbott) - [initial commit] Red Hat gitignore and attributes (Laura Abbott) - [initial commit] Add changelog (Laura Abbott) - [initial commit] Add makefile (Laura Abbott) - [initial commit] Add files for generating the kernel.spec (Laura Abbott) - [initial commit] Add rpm directory (Laura Abbott) - [initial commit] Add files for packaging (Laura Abbott) - [initial commit] Add kabi files (Laura Abbott) - [initial commit] Add scripts (Laura Abbott) - [initial commit] Add configs (Laura Abbott) - [initial commit] Add Makefiles (Laura Abbott) - Linux v6.14.0-0.rc0.95ec54a420b8/bin/sh/bin/sh  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc6.14.6-400.asahi.el96.14.6-400.asahi.el96.14.6-400.asahi.el9++64k6.14.6-400.asahi.el96.14.6-400.asahi.el96.14.6-400.asahi.el9++64k6.14.6-400.asahi.el9.aarch64++64k     !""##""$%""&&&&&""""'""""((""""""""""""")""""""""""""""""""!****+,,---./0000000011111100000022222200000000000033444444444435536666667787777777799:;:<<<===>???@@@@?AA>BBBBB>>C>DDDDD>>E>FFFFFFFFFFFFFFFFFFFFF>GGHGGIGGGJJGGKGLLLGMMGNNGOOGPPGQQQQGRRG>S>T>>UUUU>>VVVVVVVVWWWVVVVVVVVVV>XYYZZZZZZZZZZZZ[[\\\\]]\\^\__``````````a`bb_cccccc_ddddddedffdggdhdddiiiidjjjddkkdlllllmmlddnddoooodppdqdrrrdssssssssssssssddttttuutdvvwvvvddxdydzddd{ddd|d}}}}d~~ddddddddddddddd____________________rxrpc-blacklist.confarcharm64cryptocryptoasymmetric_keysasync_txdriversaccelqaicaccessibilityspeakupacpiapeinfitataauxdisplaybaseregmaptestbcmablockaoedrbdnull_blkrnbdzrambluetoothbusmhihostcdxcontrollercharhw_randomipmitpmxillybusclkbcmhisiliconimxkeystoneqcomxilinxcountercpufreqcryptoallwinnersun4i-sssun8i-cesun8i-sscaamcaviumcptnitroxzipccpchelsiohisiliconhpretrnginside-secureintelqatqat_420xxqat_4xxxqat_c3xxxqat_c3xxxvfqat_c62xqat_c62xvfqat_commonqat_dh895xccqat_dh895xccvfmarvellcesaocteontxocteontx2qcerockchiptegravirtioxilinxcxlcoredaxhmemdevfreqeventdmaamdqdmadwdw-axi-dmacdw-edmafsl-dpaa2-qdmaqcomshtixilinxedacextconfirmwarearm_ffaarm_scmitransportsvendorsimxcirrustestefistmmtestimxfpgagnssgpiogpudrmadpamdamdgpuamdxcpapplearmdisplaykomedaastbridgeadv7511analogixcadenceimxsynopsysdisplayetnavivgudhisiliconkirinhypervi2cimaginationimxdcsslcdclimamesonmgag200msmmxsfbnouveaupanelpanfrostpanthorpl111qxlradeonrenesasrz-durockchipschedulersolomonsun4itegrateststidsstinyttmudlv3dvc4vgemvirtiovkmsvmwgfxxexlnxhost1xhiddockchannel-hidi2c-hidspi-hidsurface-hidhtehvhwmonpmbushwspinlockhwtracingcoresightstmi2calgosbussesmuxesi3cmastermipi-i3c-hciiioacceladcaddacafeamplifiersbufferchemicalcommoncros_ec_sensorshid-sensorsinv_sensorsms_sensorsscmi_sensorsst_sensorsdacfrequencygyrohealthhumidityimubmi160bmi270bno055inv_icm42600inv_mpu6050st_lsm6dsxlightmagnetometermultiplexerorientationpositionpotentiometerpotentiostatpressureproximitytemperaturetesttriggerinfinibandcorehwcxgb4efaerdmairdmamanamlx4mlx5mthcaocrdmaqedrswrxesiwulpipoibiserisertrtrssrpsrptinputgameportjoystickiforcekeyboardmiscmousermi4seriotabletteststouchscreeninterconnectimxqcomiommuarmarm-smmu-v3iommufdirqchipledsflashrgbtriggermailboxmdbcachedm-vdopersistent-datamediaceccorei2cplatformcec-gpiocros-ecmesontegrausbpulse8rainshadowcommonb2c2saa7146sianov4l2-tpgvideobuf2dvb-coredvb-frontendsdrx39xyji2cadv748xccscx25840et8ek8s5c73m3mcmmcsianopcib2c2bt8xxcx18cx23885cx88ddbridgedm1105intelivtvmantisnetup_unidvbngenepluto2pt1saa7134saa7146saa7164smipciesolo6x10ttpcitw686xplatformallegro-dvtamlogicmeson-ge2damphionappleispbroadcomcadencechips-mediacodawave5imaginationnvidiategra-vdenxpdw100imx-jpegimx8-isiqcomcamssvenusraspberrypipisp_berp1-cferenesasrzg2l-cruvsp1rockchiprgarkisp1sunxisun4i-csisun6i-csisun8i-disun8i-rotateticalj721e-csi2rxverisiliconradiosi470xrckeymapsspitest-driversvicodecvimcvislvividtunersusbas102au0828cx231xxdvb-usbdvb-usb-v2em28xxgo7007gspcagl860m5602stv06xxhdpvrpvrusb2pwcs2255sianostk1160ttusb-budgetttusb-decusbtvuvcv4l2-corememorytegramemstickcorehostmfdmiscaltera-staplbcm-vkcardreadercb710echoeepromkebalis3lv02dmchp_pci1xxxxpvpanicuaccevmw_vmcimmccorehostmtdchipsdevicesmapsnandrawspiparsersspi-norcontrollersubimuxnetbondingcanctucanfddevflexcanifi_canfdm_canpeak_canfdrcarrockchipslcanspimcp251xfdusbkvaser_usbpeak_usbdsab53hirschmannmv88e6xxxqcarealtekxrs700xethernet8390adiagerealteonalteraamazonenaamdpds_corexgbeapmxgenexgene-v2aquantiaatlanticarcasixatherosalxatl1catl1eatlxbroadcombnx2xbnxtgenetcadencecaviumcommonthunderchelsiocxgbcxgb3cxgb4cxgb4vfinline_cryptoch_ipsecch_ktlslibcxgbdlinkemulexbenetenglederfreescaledpaadpaa2enetcfmanfungiblefuncorefunethgooglegvehisiliconhibmcgehnshns3intele1000e1000efm10ki40eiavficeidpfigbigbvfigcixgbeixgbevflibethlibielitexmarvellmvpp2octeon_epocteon_ep_vfocteontx2afnicpresteramellanoxmlx4mlx5coremlxbf_gigemlxfwmlxswmicrelmicrochiplan966xmicrosoftmanamyricommyri10genatsemineterionnetronomenfpnvidiapacketenginespensandoionicqlogicnetxenqedqedeqlcnicqualcommemacrmnetrdcrealtekrenesasrockersilansissmscsocionextstmicrostmmactehutitiicssgvertexcomviawangxunlibwxngbetxgbexilinxhamradiohypervieee802154ipaipvlanmctpmdionetdevsimpcsphyaquantiamediatekmsccqcomrealtekpppslipteamthunderboltusbvmxnet3vxlanwireguardwirelessathar5523ath10kath11kath12kath5kath6klath9kcarl9170wcn36xxwil6210broadcomb43b43legacybrcm80211brcmfmacbcacywwccbrcmsmacbrcmutilinteliwlegacyiwlwifidvmmvmteststestsmarvelllibertas_tfmwifiexmediatekmt76mt7603mt7615mt76x0mt76x2mt7915mt7921mt7925mt7996mt7601uquantennaqtnfmacralinkrt2x00realtekrtl818xrtl8180rtl8187rtl8xxxurtlwifibtcoexistrtl8188eertl8192crtl8192certl8192drtl8192dertl8192durtl8192eertl8192sertl8723aertl8723bertl8723comrtl8821aertw88rtw89rsistcw1200tiwl1251wl12xxwl18xxwlcorevirtualzydaszd1211rwwwaniosmt7xxnfcmicroreadnfcmrvlnxp-ncipn533pn544st21nfcanvmecommonhosttargetnvmemlayoutsofpcicontrollerhotplugpciepwrctrlswitchperfamlogicarm_cspmuphyallwinneramlogicapplecadencefreescalehisiliconmarvellqualcommrenesasrockchiptegratixilinxpinctrlcirrusqcomplatformapplearm64chromemellanoxsurfaceaggregatorpmdomainarmimxqcomtipowerresetsequencingsupplypowercapppsclientsgeneratorsptppwmrapidiodevicesswitchesregulatorremoteprocresetamlogichisiliconrpmsgrtcscsiarcmsrbe2iscsibnx2fcbnx2icsiostorcxgbicxgb3icxgb4idevice_handlerelxesas2rfcoelibfclibsaslpfcmegaraidmpi3mrmpt3sasmvsasqedfqediqla2xxxqla4xxxsmartpqisnicsym53c8xx_2slimbussocamlogicapplefsldpioimxnuvotonqcomrockchiptisoundwirespispmissbstagingmediamax96712mesonvdecrkvdecsunxicedrussun6i-isptegra-videortl8723bsvc04_servicesbcm2835-audiobcm2835-cameravchiq-mmaltargetiscsicxgbitloopbacktcm_fctcm_remoteteeopteetsteethermalbroadcomqcomrenesastegrattyserial8250jsmufscorehostuiousbatmcdns3chipideaclasscommoncoredwc2dwc3gadgetfunctionlegacyudccdns2hostimageisp1760miscsisusbvgamusbphyserialstoragetypecaltmodesmuxtcpmqcomtipducsiusbipvdpaifcvfmlx5octeon_eppdssolidrunvdpa_simvirtio_pcivfiocdxfsl-mcpcimlx5nvgrace-gpupdsqatvirtioplatformresetvhostvideobacklightvirtcocoarm-cca-guestnitro_enclavesvboxguestvirtiow1mastersslaveswatchdogfs9pafsbcachefscachefilescephdlmecryptfserofsexfatext4f2fsfatfusegfs2hfshfsplusisofsjffs2jfslockdminixnetfsnfsblocklayoutfilelayoutflexfilelayoutnfs_commonnfsdnilfs2nlsntfs3orangefsoverlayfspstoreromfssmbclientcommonsquashfsubifsudfufsvboxsfxfszonefskernelbpfpreloadlockingrcutimetracelibcryptokunitlz4mathtestsreed_solomonmmkfencenet6lowpan8028021q9pappletalkatmax25batman-advbluetoothbnephidprfcommbridgenetfiltercanj1939cephcoredns_resolverdsahandshakehsrieee8021546lowpanifeipv4netfilteripv6ilanetfilterkcmkeyl2tpllcmac80211testsmac802154mplsmptcpnetfilteripsetipvsnetromnfchcincinshopenvswitchpsampleqrtrrfkillroserxrpcschedsctpsmcsunrpcauth_gssxprtrdmatipctlsvmw_vsockwirelesstestsxdpxfrmsoundcoreossseqossdriversmpu401opl3vxhdaexti2cotherpciac97au88x0ca0106cs46xxctxfiechoaudioemu10k1hdaice1712korg1212lolalx6464esmixartnm256oxygenpcxhrriptiderme9652tridentvx222ymfpcisocadiapplebcmcodecsdwcfslgenericgooglehisiliconmesonqcomqdsp6renesasrockchipsofimxxtensasunxitegratixilinxsynthemuxusb6firebcd2000caiaqhifaceline6miscvirtiopartnerkafs.ko.xzrxrpc.ko.xz/etc/modprobe.d//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/arch//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/arch/arm64//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/crypto//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/accel//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/accessibility//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/acpi//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/base//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/block//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/bus//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/bus/mhi//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/cdx//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/char//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/clk//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/crypto//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/crypto/allwinner//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/crypto/cavium//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/crypto/hisilicon//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/crypto/intel//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/crypto/intel/qat//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/crypto/marvell//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/cxl//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/dax//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/devfreq//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/dma//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/dma/amd//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/firmware//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/firmware/arm_scmi//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/firmware/arm_scmi/vendors//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/firmware/cirrus//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/firmware/efi//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/gpu//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/gpu/drm//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/gpu/drm/amd//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/gpu/drm/arm//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/gpu/drm/arm/display//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/gpu/drm/bridge//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/gpu/drm/hisilicon//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/gpu/drm/imx//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/gpu/drm/renesas//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/hid//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/hwmon//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/hwtracing//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/i2c//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/i3c//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/i3c/master//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/iio//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/iio/common//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/iio/imu//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/infiniband//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/infiniband/hw//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/infiniband/sw//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/infiniband/ulp//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/input//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/input/joystick//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/interconnect//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/iommu//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/iommu/arm//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/leds//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/md//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/cec//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/cec/platform//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/cec/usb//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/common//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/dvb-frontends//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/i2c//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/mmc//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/pci//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/platform//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/platform/amlogic//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/platform/apple//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/platform/chips-media//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/platform/nvidia//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/platform/nxp//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/platform/qcom//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/platform/raspberrypi//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/platform/renesas//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/platform/rockchip//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/platform/sunxi//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/platform/ti//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/radio//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/rc//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/test-drivers//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/usb//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/media/usb/gspca//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/memory//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/memstick//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/misc//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/mmc//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/mtd//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/mtd/nand//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/mtd/spi-nor//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/can//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/can/spi//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/can/usb//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/dsa//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/amazon//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/amd//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/apm//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/aquantia//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/atheros//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/broadcom//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/cavium//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/chelsio//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/chelsio/inline_crypto//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/emulex//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/freescale//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/fungible//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/google//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/hisilicon//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/intel//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/marvell//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/marvell/octeontx2//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/mellanox//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/mellanox/mlx5//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/microchip//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/microsoft//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/myricom//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/netronome//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/pensando//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/qlogic//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/qualcomm//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/stmicro//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/ti//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/ethernet/wangxun//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/phy//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/ath//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/broadcom//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/broadcom/brcm80211//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/broadcom/brcm80211/brcmfmac//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/intel//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/intel/iwlwifi//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/intel/iwlwifi/mvm//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/marvell//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/mediatek//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/mediatek/mt76//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/quantenna//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/ralink//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/realtek//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/realtek/rtl818x//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/realtek/rtlwifi//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/st//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/ti//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wireless/zydas//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/net/wwan//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/nfc//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/nvme//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/nvmem//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/pci//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/perf//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/phy//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/pinctrl//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/platform//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/platform/surface//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/pmdomain//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/power//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/pps//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/rapidio//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/reset//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/scsi//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/scsi/cxgbi//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/soc//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/soc/fsl//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/staging//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/staging/media//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/staging/media/meson//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/staging/media/sunxi//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/staging/vc04_services//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/target//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/target/iscsi//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/tee//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/thermal//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/tty//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/tty/serial//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/ufs//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/usb//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/usb/gadget//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/usb/gadget/udc//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/usb/misc//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/usb/typec//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/usb/typec/tcpm//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/vdpa//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/vfio//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/vfio/pci//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/vfio/platform//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/video//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/virt//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/virt/coco//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/drivers/w1//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/fs//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/fs/nfs//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/fs/smb//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/kernel//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/kernel/bpf//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/lib//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/lib/math//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/mm//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/net//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/net/bluetooth//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/net/bridge//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/net/can//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/net/ieee802154//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/net/ipv4//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/net/ipv6//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/net/mac80211//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/net/netfilter//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/net/nfc//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/net/sunrpc//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/net/wireless//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/sound//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/sound/core//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/sound/core/seq//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/sound/drivers//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/sound/hda//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/sound/i2c//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/sound/pci//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/sound/soc//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/sound/soc/qcom//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/sound/soc/sof//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/sound/synth//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/kernel/sound/usb//lib/modules/6.14.6-400.asahi.el9.aarch64+64k//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/partner/fs/afs//lib/modules/6.14.6-400.asahi.el9.aarch64+64k/partner/net/rxrpc/-O2 -fexceptions -g -grecord-gcc-switches -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -fstack-protector-strong -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -fasynchronous-unwind-tables -fstack-clash-protectioncpioxz3Taarch64-redhat-linux-gnuASCII textdirectoryELF 64-bit LSB relocatable, ARM aarch64, version 1 (SYSV) (XZ compressed data)PP P P utf-896077a2e3862ce17faf546d8fdf9082face9840146a2130c9eb3f9da36ff696f330454cfa3da707b9fb331f8f2d55e03e690f194bc65ef8012ad9792cd147e94? 7zXZ !!V] b2u Q{L\ `D?dl™Z7&!7Lha[Z:6/dt^3 g A)ڰ-i ub* G4͘bI;9˼'![V+Lmmy L+XmWe<3(wq0<hpf0aV{UF,xj(j.rQ9&.ƺb[ٌuSyP ?@ Oj[ttuOcó=7SS>-B]fS[|4r@:t7Egdxugv$LˈǽvD9A:(q,9-[<vng5/f!'~Ӓx\VqNRu]ўj7 3уE*m[j`0{gnة%|/7myEd<$v2DKA7p.ayFʂ־4X뷌y\"H>ߛ + lpb5MZ/22%r5;vګY=te":7h)K죒N@HbӸJq)5Q5صN{g# $Q]93"{ ;W ōcc\=yPT07ZӪJVMҼD/FbрaMk!n6h'=*3)>3J1*6PIX]@5 L8͊ ) aQQbH);z0䩋v)yw``jVOD[fq~ʪgNQxF^"UíkcтƱcb<I ڀnjնǾ/KS:-,.l$+Sh7Ky~z6p5Y8ѢG*ɡR܏uNC: `\PwW/F[3yin IGQv_#Y$* R`rhxwQRߍ; SHi`^@n' pt:ږ\6X IZOL/-j-o@ڸi'|4V2ǬΓ5Mdʉ&u&jC}sh:ƖA)PE2jpw@$I9㾍k})Pbrq3#POozV̧seܡrd.ޘ 2SbRԓ6ˬ ~@yEYm.r3;1ZS6ɧ;9hzP(jE s~%;cnga -Lԁo&ӋuW#$M;n8x?dt_MBZl0}U.[Vxuxt_#;e|PЁ6}<h[S&6aI3ɂgm0E8uОEI=+ʓ3o|PtwF7D@9W},-p)|p niI` \;'0D<@fJIJb+Lglla7wbɃP,}AjPҧX#kϋ L4S˰lLLxܗq:evouos%AH ҕaMSޛahEE(WG:̈pQ A2sdOM &CJ+qO R Q`0eWQi e t(-2JpG a9I@צ{4_,V:,Я#_q<~;VWġ©K?T|7 I3 H_rXtGCb3M q:ʤ d-4 C(L:P$kVZE.HR Aga`5~5 o *6+j@{͠Tt|$Sjrd4x\W~HZ!%?sbcWUD1zcZ ~ጳo۔ꠈ$7N"xl;zm]MU@j 7e+u&}i[mDqt mu*>2kRȉ +$(xu/U-SEA6>7 v7<8=#Vw8,W 05fZB^+] RO GUJ " $4^iE~3JOb+5 A-scO Z Q堅l?~g܋)bќpH\Eg띂ՎeT/Aer㶯KHs3?a W%O7ף?ǫXr/4ŐZk9<*( mH=8I"8Z!WzH6G[;|WaHۙx(ّ/e/R0(sÁݓ=-`XEbp㘲sP-YW}0'3gH ߚ;6cl]Aό7YH2EgeUOQ\ v.bz\J#p>8"n52@Z"/4#(ĪŠX%Xʉ/^iN$LRTx:ˆ[X"!1+P=Ӳ rppX:|5l+b@xsP!R2B?ƭ]+6R . n}:I N Dlu&(c뎇|(BM 1Am{YųTxk̕sw.*udVhlV7|Ho%T)HSTe-ͤy}} fvnW;QoT\wUAQQTUTK-$y]WڪE.УJjUB<Bۺ#E&ɖRy -P#w/rTeک:Hz*.2Xpᵭ` <k䗭ul< b\f7GPĸ3-ѿ>u/Xox܁`Ğ".87O(v|bDGs4=A'1f&n1x=CJPhIeu?8t~,/CQ Uf AXMƅQiT&58[E 8Aˉ NN<ފ^kڳB?lxЇH0 6m|yQ+l1/cbPt 첎bmC~]]q‘,/g6]8(+@YيDbɖ>u|;:p+#29D a߂M)k/[A5/ޙ ]L6.ZHiSJ\6F"l }IIi=ElN-goҵՔ z0il/]>ba郕2ŴO= ;>,2*P_I_VĬ}o4 |gW"ϗ g({.3#W˷Z*7yZf!oe]ja.c3@Hc\5 Q-V ~?;F)~ErKkq"oC?iUvAazj0dqXCM~\lH~NMjH:=[gE ^]ٝ;e' Ǚ"4PKVfboވQ I U@WѴѮYV6s:S C;(o!;{O^t`. yi\mUvIh3-7_TIPp{olRv%Ibמ:O\OaZ'ۍj>J,?xK,ɈC'Esln)ޔs/Xx~ wpepq7Rmٞ`S!^n;dCtiO&5#(iN7wWoЭ. (3 C=o`TN.?h+Hu$ f)TEaYʞ[?6UOKqMm/ &zm2 &Pu?t܆HAEp f_75niZOB)(OЖ IvX흩p[޺ТZX@eGE/[9_7+GǓ,jR9š^='X{V8$-Rz]z^cf@(iëlC&1u~M}܍eVRlWf=R3 \ә'׼ h|d4;= #X%T7 -UEeޡv"1.P+Gc8H#˚D}C#XC#N,t8I0xodHD?b+ Vp/VrǑ63.|@m`Dà|댴@E)n M1櫳Ys3)J8U@Zp{X0ijnMnflŔ,S.ǜQNp_P۝/3#OI$mEP[VX)bXσݎ2YMr&.K҂] 623(Eal!5 ؾ![Fpݣs23'Q0>xʗt)}LZE^}&95xflkuyF)sU47Q a!)pi8C,H֎O1,CeYV dE QU;m%oY $~UR6f$6vwC%KSA.4e(J{ba#07+QWDt1#~pvpO#0&"<;{Oq~n*Bo]~"JHm95Fs-•W$Љ=g \=+Lۀ8<@Η.9a%"T&PxaY*sLY'1VD@Բv N@~Mh̦ԗ,36EW]`@~M 2{+D:{w+)O2ں8Y/0bÊWe w/;4W\%>]pj|8gLu=b}_S6f )YUNWos{M«* LY6oK-<]>~J$#Ī5+`<=h߃687iHDN|^مE]Z!mWouG6 ]UfRWrIe,FжW*5N Wny <,p{,G3D=@g?7Zwo=$Opr<]/6[S^9b͡r4a_ _m[7!S$HxrC"%#vl2?wvlX6vbK)%[.Dx*v 1liv65DapY[:" aDG.>ɛ UC}c{ '*`(D @~34 ѕ AV7nғpX)]>"Rb 8\טhU# 7ޖ3 nŠqp6Ȏ4㚕w= f[kx-?kg/OWO"3qL.'SI*_$adƁxJ1ս'Y61+iXyc6rP2&bgGtQO^2b4<}@0ؘJT X/wBmń+>hx&QD^{iz&ӣ!D€#mcԊYe?Љ]Ql=OtL6Vv#ri Z9L8M$\}g Pj\I<[2-u:q˲Tt)z2 7o' ֻhMѺ1V0%ʁi>`i|_ SGGFR)Y&0u>lm})~1ľ C KD ;u$\3 24'u1dIC!] ݳHZeXHU׌>2b3IA tUyʛ& a>훍W/7pxFXHg:<,֣`%aFvh FpFc}tL7OF*u̚UT0O]xFaZWlwFKCV%~ ;˞ܦݼZF⺁>܈GAȖЌNBsE F ICrqOjcz RMQR-p{VZKIdu/\\-9p9R;ᚷeӝ33\jipC4Hj׽玳z:r4*s]WhF!@_ܚY 5fJg7EK+rkGz)WnA$ff e\E0;Z{]eه &:%-V+cN׹Oa|reԃ8ʃQImwKij{ 0k43Ԙe^3`F Q̗?kIׂK9.SYl֡ʘuzH(V X"Yizӓm/F~ߨ|Yol]# h2Cq~$fѕFq5K-6յR1+)q 4@Ա+p*s&pCZ= n: C8kyh5P2Vkjt^wϟt6i^k82)NC>Lx&43"9m`a} <[( *qcGbx&|zLCmI]Ls)ɀ|[S:|>?[U 1PU㡂d?Cz#"C 9͘zU8 0<*Bl)rT̔}oID:))m Uͺc9nk0ndգ&K:w t*#6ӌtKQmt 0[y:yKtXb#F(lHy>21j Z T8V|r3xm*Me$V{9]J3 <zEo~mGT"A,fMp!qp]1M}v8^)^&zC=S'824 XB@ytkHB:B/ڭiFK cj>"_smXA B] Q. lQJ(vU5K9׽7E@,Gz4xYыVsnw b;ph:bmΪV+R`A'6"Q% aLV w׌.h608&rm#_wF|]dls9@ieu& ?}%Nf2Wӣ/hD!LK)} Oî0_ cNk+(oJ$Xš-C>q4uXdjH!N̓ٳ'j& "h eUڇu mʠ>QQ&ssgӭ:> 0.lϓ\ɶ^҄3xK HT&p-DJQfmOh,Fkj*ht|ͫGȵk6'M( *UDƳmDMT>q&9Ӣwcn+%eý#6kmcX>I!(i"fDYx~ً5s!+*40:="½`{Su2``=8H[76%ָӔYS#Ϲ]&[m[i2'{hMi¡{YÈ%Fvw[m`F?óA6] ~5,&V4"if``KqGf rQIJVo:iKΒR`+pG/8}c:aoQ#4457`ԛlg\OK;Tū5u:C9(lfl(r%kPk(aHMALo# Y5ou5Yv]!͇웩h|asNл%XSNm' TvhO'gcGկP! + Ez h08ȁ׼7tWMXP)Ǥbe ŏ?{מ x P dk磢&Nt L#/ zZ/zO~829@5v2:zZ17uKJhK'^ڃLsěUK 84r̃/xt2H  +vCs1);. 83K*jޕ\?q_S8'3YvX٣vco# 3K*"MiDᖶ 6ڈ˔6 kra6xI[@ُt? eP!0&G"Aý{ .}㟏}a!.RifOTPd^vzbg`#4) N}V Ikb}~Cdh$YV[h޷:@ufԗJo<~ߘY}Zk7~,Q%8CC  ak)i.n PSC@A("gNOt̓0{;7lg$`K[3b#@(DK/|LJiz`@34͖D35x_AY**w _E>?%̿k 9!G>?ӊ tۏt5TSp'p1tqqRB°AFE h e-Pɣ₂,NESle|/%QJ)3ۥu9u23F^׷"SGgmTbd:^Xs{uw+s};=2>#+p0\j[FMx1.KpQEWKX-}g n+r|CȞ,;N`׾ֈjƵ ӝEw3w\ݎr@xC\Ӭ:%IH-J} Wr .+#q5ҫ 2b ݠeC+d^%pNhf5:i`PRèZdVATg]Kuw+JO=|\]XL #~-39(o w:m5MW;]k?Vz`#c5IYX:8oAm=D^Ҹ`tTޱ*0F+r5>Vmⵠ\/S6?r&iòe^20/gdCc=S|Ɏe"IJk|~@.dx+!7T\ѼVku QFDZMP`dś@&|JieZ4W.Jʺ}pXUvt+/g9Ndp<sN*_B%91!pͧLo.`d sEjsGMXT2ZJgUQU*tY T@wx~.BVڽUϑkvDa0)1e[QJ*x z1QN2?`,YO ĥRɚ&ÂasPgȪ~e M9*t>(r챝.V^]`tC#SxDfNeg,bC\0=2RHuz;͙{F"^iuMH?$2Kğ^ w kMgV7W9lhItԵk <]E4*A.y#7&xYH/2(kcw|JJd[ wVh|Y$-D1bC<ڼhqYGz gnU^~jp\tC& 8ATWIǯfUa'>| Y2;Z,v̬qNx!Fgԗޕԗ? d6庬ATZ1qo@4@\VDVYh뵫.|0ubT|8=yWxS֋r۽ ̏OŀX)vWrT}m1ҸYAI84L%jlM iZw})+7Uz3,Im4F)b߶U%è_Z%}Y>V'sZ=O fRXqBY{3?OIO_{88AE ʦo0f%tbWV>Z U˵u~Q>tv$e8ulRԳ2axeAh삊qToMrqs#$ !{gX(uk8;pOx8@S:Bήr#^U&'lݳ#ԡ5/`#i%G0l2XQ<#EA&:Ԫ@^Y<3 4VTQ3l.He nITm-=NvWPza#_n}qqk(6UYVH{\}ճ|Ylxر4(n{%W-<))Qˎ;J YPBi(`m5=t.9|*yI.*b%vW+ aoF>]9tiqXk`1N4&{QAt q4kE`nSrh2Ff§CzgB3[;}NfJ/rIՔ7r m_)LȍnOfB.aDq#Ytpv@,v<3bd1S&{EY/PAOf׭~?:8J~4nNTene8&x V5[RltmA?tV|[q6_`1icS2z3Uԛ0hJKzwCa5 SpnVlE1]4aFZ}hYjI7,:m+ M!p:]ǯk'$ \ Wyam)FɊd prw,Z.* X }*6’E>ITMZk/VNcXMfs'  Ƈi4.,D-C,%fgN3SJKopy!DE&K/ʛf~:ӯ '_ wbpr|ۍݢKeI(Av nіoRx+I.esL]Ne]Q!w3=[-J7q7V)B)fZOd&J[( A*nCC"77%Q` b?dŏOq8rkIL5Q/TAǍ@QY] ƣj`-4.Jh@qBZtTgtG'WV)FhWD1МFjsUQ_:j` (BE̤Tׯ*H%OgV1^F[.>ACA\`yu/qB!prͰ擕aD]|q\ҜpjE 2WYκMS 1_ڛiK $`JW+qE\ ~|TPT9Pl"켕f=%Mn2I%^N+l #>{S5Bj_Re VbJݡ(bWnj洺-۶ `(H19o' $#ZB_mN\w =o7dkMg$\=%-z6Z2a_YA3#_/Κ\j{5|N3y/YɛpɡR37_%;j{)lL9KD ]_$풃eaչIq/**_ەթ?eo`DզZ@?EEvm[=L G[AޕW7[CM0Gz!1H[c=HP&~dm#İvY.4r|6 q BB%PM]{*PDFzgAx*5[U"R{^֧vuJ?FIjc}U"I*d?ܨ\Z ݧ==fm}R M!],A V8?4Q8vD:cԩy`Nhm8,2&GNCVNh֧g9Ÿ)q3xom?'_ * 1w$C`T*h .W2wBߒ/ЃP%t]A+E҇Q6,K XS)G"Zf[})W0~񊄞]nEoXK06/£A<>بIkzNT֊Vbzq;Hy_/ RۏxmmDD4w&L4 ՚]&|h:0ƾSCc0ѡD%'Rg2S3S=l!ˌ&%oYޒnƸ4YAu%x @G7?r4=JwLkSoVf,JvCnG;s`,gℏM$մNи ^YH:mΖ-{z"{@;~<|.j/Fyqͣi'cl=L_*)3gz:`A:Rpp\ϾD[D4GAcL ^6T79p<hG2*FZ;}¿S@ꦏ 6(L؃3 x LQq4ͥ42oÝޕ#- k>1uU)- ̔vޭt5gi[#ʜm-xr140߼-hBe#J TuH+\ }" U%)N&Rx . 2o%7QmH;vmZt2Ǒz%S.E1cځΕV",P^s<{:?rI,8#˭#a,ϺslgƯEF>Ѣl%z65l?PF0s$S°"#eh91UJl_N=-fdU;bؘ9 U{v 45zuGfԎܪ5)xxik>:ӦsmSv5N]6*MYU rT[x{i~Vgc:Qe7{dxX?pK%wnN/4iu;;^dN'] 0,G%5>o[{YFL۝Y6ӧ_KB&xZ~9 u*˼EӋ;ϛ<l# H3NT,Ǐj6/}Onj_{{"ț:P}jY;V 8"uw,Q$C% <ά\!;e1-OD.)?%j |yq&_gk^Z}+VegC3-ŘZg5';ײ{춝^oh|q7Y{kӛVVf4Xbz1$H%Zuձ?j}L?5sLbݲgJyQ$D6q6M_y,쀆CL6k#2~[he8TW,^:Nvgj?ﭴ]ӕ4r@D{&a?4?K\5p$[?ڂ3Uj?_EE=Q)NL+Zik&]]~a 5wr(?kOڤ?]\`:)_+䛄HLzic7ߤ ["3%d1[@AvSJk[>{6srJfNԍNy{T1|?*10P+dqNEşJ?4vŢVϭ e tWιZ?(>^r*M{F6zOG.Vc% f/.ָg}ŅW XU+co<>=K ~,Ģp฿?K >/oWQ39TSwXh+F˅{=TVH<)gD'sDI B*=Dhһ9Q&yӯ3qbnzC)'ݡ{ ɶKUNE[q OZ/\Gɸ%u^LZdΙGJ7Y'm%f"F-Id୊SڑXMG9_v'=DrUm8E'hJWu 7'v^B5 Iqm͓}UGD k4B2fkRzdY1y>PޤȎ*re voVYNC '!x|Q)>.A(6!VSX^ڬJѰ>Q־P@O9[r ޅTc+PTuҖ혏;-XDCK(5IMf:lJ.!@X`3?_aښq&TsQ C?Xܪg'HB1JwcFJkBh`;@ElKrSnR[kr:zC=pJ[%ht]@z⪿ebPf1# SaHǦB4zGY'O[Ï x'W$WQcTHˬky+P':10SØsބ}3QRa!5 Vߴ#+O=RQY^y7ʔ٭#Ţ^CHÚ6G(6Uw":b'.2r}:LIAyiɦWiJ]:Cv$̍yyZhd߸˲C1rm̀Mi(5@og ]"|)^>,y_u%468c'1h 6ૢ)>;`8 0s|dcs/ C*' ڲpThMLi{4UuPi`5$72#An_%HtgfiF[ϸqvfkN#O\THM;^UFmņxo$ľwJS5X8fތ %$`3JIgn91/%X4QXzଥn[kGNqG{ :G祕󖉨PqH^L4-Q=ɾAs\4_ 7od7m,?ԑs ODH`վX_M>Sqx\?@ w>w.FY-ZAV?o>Hb?7{ OK.O|Ľ=6ýH茺Dog_vZEŎy.Eo`) MA-BH, t|"s*ޑ[I hX N TQȏ|9~/]ayA៱SHΫT9 ){ p]\!h+;t[9GQU3Dr\/Ղb>{+fJ؅eoRF=˵|)@C3|.drPi{}Its_3 ͤ72NB9NOpji6M#;-J/Yx(,/äe]xznxU\3L 7{?!}q&ikW) ˡQG+Rb"7lTT'\`k]xWNDݙȶ'y2=>P|7҄i4?-r.H%/9e$8?zԆ4P-S.8Jq'] H\!x>7jhh=/tQ]#˴üݥ3º%Nmtg5`:$,2|ƴamѻ'=Fok #=Ζ4!?~R@9褮}*}}YmNa8Кq&Gbm`:|WiϠmيIJπ9*}(CLͦbϚ֖ g{mjf/sҜ9!Y63[ޓw^Ջ>\tpr>^&A 3Rd7B&#MRg R~HY$hMvRWM B7Rm'bsGُbUE1,Zlt }=H:Gg̯{#hTwֻf!e9ki1,2b_(hygX 6 t1iLcaǧT:YlWq%y#?lfnc,:[Y;Q[zx(I-N}!+?x4SJ wۅ󝏀No=cz QeOa2Vp){~wuӢVMnA!nNIAB #@ qͮAČB)q6nR_&I|_Hh?rK,Mo$ż?^T< `d%/ykC,>Sr几{±/F$ rx/6ˮ-Lt7y5n,iVU8&wQSUAʼn羄tSZ_> @Z\Zet튘y]4^"($ MUfߎµx~>_jۢJ~7YBKɌVBFfAq˫ԔwVπPiSQ3..V:.7ǹY5EwNh3J~˛`m8,Yg!}W@zX[4#,d> n(J(֨yI.*ɼMtA;d.>*W-<-~ӎC 179QӁ]\(ʾ>N`Լ~Ծ23{s3 [k$rɂ;'zlS ˭'ZV!bM겫b)ܾpIsk,K3?0i N߼݋]6 5rqS]5opB` 7*U=L{MO(6rf(Sfo>d>}:YהmTͭ&Ysy-Yn\W8He&acIj.h /,pDqf%s;'1]cpP9ؠ?d d_١*=wn ϳTХȱ@ע(@ustb[&P.ˊhQLHgyfa'*`5,6Lb7UL"A.S~$!NyǙ(*?FAQ#stCm!W#F}{}i\u.09Oog -$ةwډAVS]S(;+=$RUX.PQ! ->S/TJq'Q^pʖ~h̔#0A {%7]I{gd`` -;%}WgȫZ3L'O }X \I<]<<}5g'|k*Θn>M=6aN H̯dL=Rx1/Jkzv7!LFR{5S"L$vY=e<9,/{zˤ+FƞT: !(sUC >`6,$?></#b\Ͼ5`g?3*_#H5CN޿\ \%o\[?z?;m"Б!+Y fm`Xl衎s;^TS9aD+4RER >+hAᇽ 7zqm 1(9,ʧ>0Nz[ܚ):y[%^-vhl%D>iCpq o,uᢨW"& O/U6ӭ[<=_*jz~6, @Qw~JLa|ĭhxoK9Yz]ڛu]L?Wlsoey08?-} 9τ@Y *](Xh/ DBLL$-;k:79( O{$|'' ~E[k§TǬZBP dE‰VM^5"WM_KIz ш>u07|wb)Cgp]5)?g}d9h7w/A[7@pQo :f\H3vy7>i"Ċb`oZ>SUHJH;f |PUݩ!kR QƚZc:"!P8%ĕ>h`Q".N7KYjriMYB/QRaT̚MoR$n=4#_ ÷_bW;W6BrW|,LJa#kOȽje`{ Ka.%7N=;Nyfsڦ'=,:_UIHqIH_6$X*Fq#>(1#Wd${"վRܜimtWsܟF@-#PCf2xy=ղ|?:,>늮 {OctBg~ɧsTv, M !A-RSmt%m6QW[})v!1Ë vs(TIod/=:mLOu"9ܷjQpۦsN|?\c4c{zbU2Z]|fJ"2_g.44:'s[D z9͌詵V04ՁO;Hc;#3Z?ޮ-qlg8';B"ac#p?b!j\E^b osGXTK/SAAHNbe{@voVw Ef@'=P/==e sj]~#ل פ )"(De[ych}9eOUVC4" fҳU.6 (@)X6UQ%ʮv~z0> ƦTԵ[nY}k;, v> 1@M@{ rY_UY8l+d茅rߐEؽVVuӢH: OmG\Z[޳`F`PRRi=@emfdO˯%GUEܝ7xo1U"j 羂bKCEkso8J΂K<T "zv& /lj,2+|7gOYl` :PZʄ)Y eEdӤ S[Y&p=dţ"U7/7@ٓ|)Ȑt3mU4Fx˽ ێ >'kGdrh (JɸX8s%3[%Sv"}k~Iт\3>F#vxau=&!6ZFoiH&qѵ|h7uaDdY>p8"O4:R^,[C5}2jSdy"A9W\!Ċa"r'״?`fo$*.ћH\Ac<Ү[M@4K{ƍy1$C`0p۵V. O*/7 ˵DzG EiVu-R1㧃͵m+L­AsΖ4Sث , QNcsb$]8ZAXKţK{dZCCdL.ouSZ"f}UBRc@p2SMMzJN( 8UA``/BKx6t`i:#FR;K9On?K e e'%SKdYYi³/&kJ'+U UV4K{,:+G)Yӎ*G5[A'~|##fje춶i[d+uZhnO-n[gf+܈ե+wInRCrj" :QQmP䄴}َW$fpDK̪ *ޣ6]S1' m6A.j;aYneѲz!IL^;3BfV?џ*}7Ρs%{k@\ǥ8Blm2}$1m%i%4 X}{Rͦ% ѾTB OAլEПBκ]m;gʐr*C4 e]WKukK@)г?,7͙r=Ԫ-X9 yCn@~xrfϑȘNDV۰ D$zA1_.y+XFLUoKR;gWZRօ7[÷Jd#+b[sKo `5]n{ͺpSM1/L*[L|/  P0 6gWpc򌚑JVy9s;% NռHA^q)5Etu #cӮ- 8*u$/}OkdKI{-,Ne/M.PO1i=|1oO``,: *KǛ> &r+;7B'#IG\1Rx(%?Ja693&nK3B)%, %PFڟUl{}-V@wCĝ נw]ϮHs=%$^͆Lr̴P,l Jg69Ӱ\q΢A#* DYƻ%G+Eѳy( !w$Q>#7 <u85* ~I5::N8-oڒ(볅 B'ֿˎR@?rґ&Y4wA|䂧\]զܣ0YkHKwDW$U ^)ugC2Ͻ#S>l큃2JfCYfc>]X89f,hqΕSu=#=JyJP MqέEhq[᎐2S%Տ(>dr#sMuu?LC&9jm4&TT P:D&02ib %,Yw<Dq'_˒"z5JcAs^)%^ZtH!nI;JI*7_&ٴkh:72Rr} y>I ~([.Idi]W jt᜽mMB@w -]~3+kӥ'7ڄ[oxۘeZD`r /ވkD6yLVlfCv}XRJodv_Kwky ⲵ=Gk$Wa_Jc,*3Ț &H06|T9N(gZn05iOpGލD.K y@KP,?V|W.'Rpה72cŪvȬ81j!%wvSv7`%$hRp֣HlG&6la6GDjxr3JgLrA6Q ÃK:cʿkǢR(,E$27$qB#P^.6ȯьg6"A:mQ<$ꣃHgg` rGbuyjˋz<ҿaGQR eFt#Eo` Yz@̺ F0Ӥsaո/:R"&'Z&)(0/17o™pVP^f3эsBb0'x˚ S4jhb7Rz;B|aqT ~1t ;QXvOZxc·?WFmx < (ȉ}5#Aڼ-{P5Tk,7@L?֣ҊVXuL8ZR| fH[fĶ{,w$TA䏹bր7"588`:ˈtբ,(8(bST]w^76)ྣ[T/pa]FpiDZ*{w4*RPw+ҩ(cBƞdG^,\Jd2̕/߄(`Ssبj_.1a#Ehtm/!( y,lM8 o !̣^Gu+&P# }_C61Y$GoKȅ#\kL޷@J'$ax R@޶db IaRs%ccZ>O}xH9*"9UlldJeu%GQB}8~Fu%7L+|Ýk|Y_EU 0"p)>(ZpC5QyÌg8N̞eZxjug3Y㰁N.{/yLz{ͻ:J_U=)'Hי'a9s 7b:d7+E X,q(&cl|ۇb"DenUox7s҆g NTY Y^7Gj<|<1"Áve8iMfͣ`:-AZ&|jŹeEQq6Oe`ƦYZB`y8.wr\XeiߌnK<^{t #yw z#k_/ss0Uu0FVwO迤kVdAQ_ذ(_LXqж52nv4dɅuXwڕl |܅Z}#wV|&!pd\Fk+r.~ yrF6ZXV*vg 'qW{[t ?{gPipw^ճ +RzL5}#oa-`pJg:2Ah?l yo{Ehљ+_9~j;Jf2ygh|1ڹ._h{liԓg!}c A%J]y#䲭[P6Pk2>nuwT M =JiAߤU%6=e ITvkJ(Opyr>)v;o3\j:}JD'7Zuc6G9 v0W)0JyilZR犲Yqم|w d΀~}3r k9ģXW -0Ow 머Vc4pv k~ %@8~Q)_lLwj9tOXe㣽l ӱWT%D6p|çt!X5[|nZz$5eMGQ3_L#RVuG$R/ `l9bG=6:nTĿܱto 4zJۆI0S׸ͰB5dTY'A ~YۆnMAv(NZ&R:q %ϊCWNn8Ey[,I6-zd GiW~?yD֌- $A>)RF=&9' [X ;Q(z  ך=&m[Y"O\'jǟGфeCsXb(isCs]GTՔZK f8=b"mCX*:H@IEi=5JǹĿ-`i2Rqˆ>a'yTwN_4ש==rG=&E8i3da96xfFP@c.}R3 i^ڕ,6LJ p"BGauuyUx?t(SÒ6P'׿{Ws \$PV-a ^+ӈQZD\ m "A8pO0|tk@NǝN֤qk )Ya Ys%iwأvH:3`dek %< HI)O- _HX-d>Trژnl,a*"uSX\qnщV]0_r}=ׇĹgЛtdEp:a2]L S~J!?~Gf<-]#I8=vg?蒱bӞ"ne {jrJN[Y6YKEۤvrwcSMukF VH1k.QWH/B)͌j 5 4Mߗ+^};p & 3]Q8vСlҿs <ك.X԰]o`i2u捶!ѩZqgT+b^(.(-].۰Lݛtf?s/5a&7 [? D_v[*1,Lrѐmqe9(UQnOϓIUVg:; l *#Svd Y $*3F^KTQ:Ri+"tȭeHc> [] 1Aw. VSh+ý*g؊Ŝ`VxDJJ@2-Y z-xĺEøÑ\ oz_]*QOO3KR,9|}aχ& [bonO ~Zf?)GDn#KCT2'VI_!-3c=[jifejkU/GI`LHLq9p~% o D2AHǍR5 .> kgJa0Jֲ#ÃN6ū>SJ r\8>֦e+6볤̒f;B24Tg+^w迏ɽ[R2[!1.?W6yfQƗ)|ZgTp[g]2c{.0*, ){oa(Vİ|_bmҹ)yxZ&fB3( iމG6o4H3X'SV l)aKDE},k6sM@xejD(u3槛H*mb<[w~{{}#vKBWm&~K*s 3La%]AHwfS`# Hꤋ\\,f>h̩.' *Ay ,f|VV [}:^wHEnKnɜ'FX{Yk]{͔HxS:Ɣm9^7 $'ni~w=,u`|w4i|D^j.V?nN]EIHڬRS(FG\<]pzP UJeQZ Ʋ˄VyutvO V; `AtONk-$Γ_z>7δR @\u)@*K2mJa.`uOBv268j^4 sؖ+c rJ+DmWL5w쬱Ӹ# )Q]ъMdwmu 5 u'o S%~l]*L*dg^9*/Ø]{\9zC.VO d.i<"&86OP\ZnŴi] Β2# 212c!&pCwtTVO֦B>ҥe3+3P(tCJh^ѿowF-tjOƦS0$`Ӿ^0@ `PSl]pq fyl*ag=X y{10p;WhT.eG<А}ď} ]? b2zrDTځQC6N> $z{4e1e`);CLƅI:{U9Dᛯv]WV* pNkf 1X8xj̃b//niz56E`'[sVze.-?*8"Ly].YIuKQ-1m=y&7&y@dw"SmUoeѸ&1 I sZ]F.u,ܟ4\nUAtmjeI6T)4#P Zn8~ӗca0G/!OV-7C]6 PjUhmR η(Y ]GeJw(7tcgd/HG2SAVh ҒmšgRo?\btwcB > 4*Jޮ6yxϤl4ջά)}ؑ4ϣ lo;CIG{/"yE{S`Gэi:޸#ĉɬ9-Ԫ1}lJO~kz2]-صmyaY *SCjF[7"( ȮCVvOר1 ~lyN7%7"0ct֢/])H3c6#&AiĤX/>Lȟxeٳ\_g!Y%tBP1,Jv0>Ɣq^sWv!nv1VԓD:W% |s>Z+H>ㄝb_/W\o;U.$1õ50ݡ+gSÁ+ UArT?&-vkH`o@:hg7m=[)}Wc1!~87hGVNdc tF(3qyLVV V-G*8[p 3@ٱ E΀64 ]5^2Ŏpŷʙ 1gn݄+hrkJAF79\>$Qa/*3 @_KF/#7+{ߧ\npъXtcNfsM{ߐ]{$ >gfi;\+ӶJ`G&լA>taAZgvy &^;:`R0-St- J>d�Divr"6[l)EDބo$n<[v%zZtL nZmOb"iѿd&K0킸"5E%>WtѺ9[)xɻy,+/Qs6e{ă/Ϩ)n~#g۝BpD\7`m]#>t|Iθ(0ŒX~29d 8ɁPT/; I]j jByM06CJ(2Tr踹kd8RR9(/RJ:zv/H ʍ֟E,jFWxaVӬhM{|4ܘʁ)Wd+ f`XHh M>tkXslp 4sAӌ^c'-::rB69G/mzHJ(%zuR,Dg>їAJ@1܂%y.tFBȦm(UkWN@&U\TF/? my}m }fW"fvwDVʾ `Z#~9*n#n4d3{Q[5wu"#)ymkdZQXZd;PHdë'q~tw"4[)˕ ID,QA][\?FT Je ޮϽNSK\ݽʅZ[5P/KILTHV?PyʟC\6^kUSMK":6fߏ׎ C9 !\urڽȴo4[V4 bfշSµ$ibozƬ|+Jm${70!zJs'w} &, x_ۊsf,`4q}o4] b_\,$&#Ay=DaTŔ4CqQKjo/; HdR ÒN#)^S4â%REg_a[\O_0!Gi{k%g=Pk݌ fcN1`IϺà Eg%;ċ>*P@ V`;T/kzJ%[UGd% (k JD=zMt9⁦XS 95$7 ΧT2vmꖘM1%qZ+SqbX06/^0 Լq;xܦ 92fGnƙ|:BR#C@tm_To h}yPDǹ34^[$oלIm-]u,}@zuqb#tՙy!&UeJG?aNsFMDҤrxG$COIk~HWBטqlg6≡cBDl 3HRZ,%8aEmihL L ?o j6H)45 kirh@&KH6;pg+ _YMZs]z}c(VuN ,a]a$ BY|F,e v)5-ᄖ!XK6 d|} bmȍ?k54 r˷#S8xRvrN 6v<࢛ Hs" jJ v 3aDtD2~Y i}wk2o8C\Π}N|N"%`[ymD6jlblJ|};{.h+wwη&Eb`'xڝEO6C ʷ1@k5=znxdRznEG=f|^|mqYESLAIMRAJ# hrnX0Iri/8ؘm`ఀH6pߍP|~O[Jg؈S۳a]Jn|?. K!hyx>Al܇3A:_wBmSV{k3C`ƫ8}=}cs,'"!0vņojqO0}MB- rI{YÞ6 l297`s*!~hP9i1CAVJa*Ѻ|1.[ǬvA,vݰ9VJWHv䔫\*VAohb)l0n=HAEy"Qhی@9E(v P$ýGʪ,KVUK$?F8xM~oD#wp]Dl}Vj2Af  ;aM~a]p- L R\ w;#g{LH{k(sPf&Q=kʇ^GVCSaٵ*srhƓB+GP>Úb zOB(yd-; tG6ٺ9m'gǪ.h0u{=$r\ſ!0:o:rݛTЀ_lG_h&\GF mбm8lݠtnp=oI5pּ q\H;;0J_^d?,N-_rߚa746b$@qipu E]U gqL}Xj|δ:7 g4u1z*vG q3X(\?^6]:u`u yyt{Vz:ܰa,SaDWƚW6DL-#Uuپf\,. o|}w%kd 8ahsv 6 Zz 58bhBӀ b90ÙzIF2:R~Jʐ5ӡ/fti-^.编2ْvٯdttBFȠxqq_@*q 35km橑586}P><=+|W#I "~|=$6`<UQm7B;ayEt?tXCr$4υ~_ ;Lsڌ-sazI+NSMMk !T6G.߀=AB[(KF/ޥ̜)Tܳ\N>Iܰ #LfPP sOAǨFgIasE F Eͬ:="Z\!Y5Fptub fHZ#mHPngk{v{X=|H|:cWqd\ߞj90X.2&-do-'h ve3i(gVi;}_;0Ċ5x[Ȉ=T eALZdvENk CKr`fwI޶M^HG<5`X=wj5rAr6BArn=VCs~R!Ĺ%]}Fbs 9-&+_qpA0%|*%v,ڋ]BQiA,0Fz)GyJ{/!+H)br\ʀ>MC[;)5]\c;Pb37:S5+ m~~P po 8ϖ^n{q i࿮%>]atf|%5( ozk~XN7v'sjFHQLS]O8:ϒW~I6-aAG "@BphY !6މ`RԈ8ؓa6v[^89ņ<H+gSɣ7iKoKf!d-l5:X:-Dt6zq:a"j,4.!K^*arWo_j>E ;>8dCqlA m~M: !%C3*=`*ܿV*^! qE:)7U;"9GyEX;zYEZ:ymq~'3ubWN| K*p CFhWS asL۔f3gӡ#-arsm-=oI3e kjYrVLo{zqoN;%Ҏ]s!YXqM'((F/7D2)Ą w6/, Xwe,;ĜnGlHй77[#?KI=cS~R~E`uRT(]1z4@&ؠ:A:xje Kz$7.dȬKڹ$Onm`炢TebP O@ ϨZ -EꄟѤ:\_KJeIrdqmQ &} vrQUNl-z]acdÜBZMEB|Ұ*uci<\۷cUm+:jq7Q%f0'v;c,z.M 9/S,? K5RU+ܑ0Ѵ:9 {T'oBt x~e:x{.I}sd"W"`"-82ٍB##gģo ~O<{cW&;KD,]k͗T :e:˴+ 4{հVnT%ԉ#Y Ļ"߰pOG2߽l0IJ0)\;cd:m F}ϺP [hn[D{Ey|*DpљBeD!rt﷭.ݮlyFfA)^(Num8PSQXEn c+$eaÊeW,r`&K}=}Eq"Q1މ!5$)*{4dVg%3`Mn~$KxùE"H2;ONHn 6u-٠תGΝf-2l8K3n`U(8\!ԏ?r0|n#EIa_t`=_; L+l;J/piG~ecJg! VWg\~zxr];BMwkҖx CC\ q D^ǻ|OYp"8fCBw Sha(ÕipÐq1E$eQ9OɳZE3̷OqrWh9 GEe^ʼn.76^H<И=!]SX,r*d)q3g2仉x@,@>8YSk!L4ni-D6؋m).llEqK<)5\q"xw̑c$|"}O a=J=JTXsJ#t֘&֌h()h)=&(rYi ͱD/:xٝ1Bm`qYwNSϜrQ$4&~SP &TnB8rV޹.׈f N2ɒq 6^xmWsPY,=3&⮲0D뒐ФL+l yv@M,PPW@+P22y;-}\fyt\lC5*PXkddCe-R oT`%"3N!@$ipO5פY]˸֑2z#1ֳ-yq 1m@\6Ƚvdgi\[$VV>߼X6o-#i 2 K\ݾ .lT<(qPM¦ -l o"n u( ]=i)Ʃ0_2@ cC G-Cbf4VBk'ib!kx6U.`fwy#b+ eWz!g\`!QE;?B~-MBEh-2GZn JVBTҚ߭ lKJݒ'sҼ_ʯոϩy:Y~nȺ";TyCT)rbQB~pJ+` qg;?I6>1CfIQ$-mh}:I)eyA#>{zHI5hSXM${W`|:"t\PxbpOtMEzO^pmK5sDv6*nX|7rIHPYN\ch g2Ѷxσop%Q m?Rs"9TBV|[jHkZR R4uZ8}ȣ;ǻU|abmC$hـi[`qGΟn*/L&T[ RUahu[V7yދL|+-v>y 9KyԪrBpתwY#H]/*Kz] SxW{#2i8g t/{n+eJU nAuOJ͚?$yti#yi>?s =%?: D\V̼J@鳖G7ŏF"419ye 3F̄%ZQF[C/oj=Go3$eʪQ[IrXg~aUxMavz=&ۭKgh)g<0RvjY8AhDm' R6Eo U]q.b,9 `5[>O-7^+six G|%z]8gtWLhv"(^ 2@/޷Ǡ.YB ܹ$ҟcIcOyƾF ֣v[<$j䋇]91,ytsKgijAňu :C@ϒR-=_9\(Ѐ<މG/+ayhi]r~#an/ht=2n6QcJ`sVBoL4  fTEgܥnG<62ђӺVLJ1z99 Rj5w5$;C،ug)iH1K FKqT^;-@y)?cb؟:IGvD 6>|?#LzSpP0|c{"s_o]OKn?ʱ%~2~Z.!bM<)eS$9,4A=."מ T>$;yFF#,*AnS?ߔC!nɴy<P8*xH&1Dy ; i0 lEߨ9vkUIE@k#' :XEmT'9od}"qDVT t!!ׄؖP%6ZcҲǚA0#Y|K NLVҫCBǭ& 9S8|2=:BCu׬t\L!'T\J5v-dՋP6WQqX ¼¦7{(!g#S*U ]=QP 0,tT2!_g,'kYlCj$-;zk0!X8@X*xZn*1y28i NY=K`M_k˒U?5&cN& <XƳ F.5kޚC:pH{oJ8cC qJl2 iscJ@S"̝rN5C뾮~ћ56m0MD{(:'WHEJШKUu/K~@0W:2MH%orт|ގN C"V{oxK!V U{h1 YN3<~Zhg6%̱JʡX Un= %o@y1Abד e:{qO:li⬪4M!`ox٥(p*>pzP|4,Ԅ_rN3}ԊǺ8 H%&AX~Gt3we7vƫ5Dx}ߥ{ڥyqU̅ӄjv3 "}B+\< Fq,ȵxG+4 %۟!FqإTE#,`MB` Cdz**'/ +]⤾g P@J-"C5TF`)]0RD\*~@‚ogޜNǨjc 8%.ؘCV{9epvlMN2Ƞ4,t@耶+sC[;!N3VԘc%\u =B)s_=LNgڕhD#+U,Z2|w^9 +o~q`p1K#Z`>m+0tbcXv#jGFߩ\/V|AUUWh6׀٭)ur#|{FY"mL wl/6[(T^5RK:WIڶe.Vc7 -t wWFLq.F4;7JHO][] VʩQb5k?, ۝uשl%fc9nQh=z:q^gM sKMuy~qN+kB4^u߲2V5Ѯw tj}60H۬ۺCf Eh,4tf_5W;< B:8sf i~ɳХ )M VddLH!K,ofF5vBcTIVWXi/oaN*#4=ey(";'t`04֋c(s=;3Wd 7 6q2> B;UMϏ 8RK_}bJ~!HD v 1GRa:u@1Tqt"ZтmqnWeee(]:1f:>z"ea$,=(9++߁ξXo?8X@fQ[zR85èa#8(Ls-ܝmձu1x\4ޚM)1(p_,V8 #n/x !%4R"JCVk-a/鐴Cع5蒝Q;Pt*,r/!NRqD *i ({iLU5!k-E{wɄ4|T+2=9-2X.QԮ$1`в;. ?*e^ԯc^2{أN0\XO/rbn0"JLtx~&恏gֈ:wCIŌ&*7 ņgg8Ʀ3[*xyg )лTlx\W!ᷟy.Y;%6k(՚%WcnT J9W\y!TP=%uQ 5敼1P ϒBeh5[hY XHJ%58iA;iRdq<:ⶆ ߵuĐ(BL* nx2^Ga$p}?r;y_[4*4&共%~^v Y K%XݛB$<@CeJP LgFYe3ܱ]_ExZ@zҘ& 6N#'RלC?$4p51s1I !՗Zv<=_ZwIl`3ED` }*ػvVPt2+,ew)B[xL8-퍜FTw{&bA(ү *[]Un̡\ZtNq0w^ݥsw8TDPh8)K_j e#Y9[uHpKq:AL-e&(ث1B2uϧi'i 7A*]9Wa&A_˅nç[? 濾G{6KVwznj0kO~b [mvӴX8vȾaYfFC) #97ƶ#"S} +}9jf(v}8I)hoZ\PG*o[QcbuvžUv4{,91,[1Tt;&2L<%$h^j>Qn5cƷ),GbIeURVdc9)JAž!).ffAr?_˭ufE^?4LC`2gN綽Eч~T}:[+Px#rm<}R$Rq^ ōG&&n =0/\Rs' g;q1=tmF~^&4q @M3+Z"K] QʈlL$Ϋ]&r=ay^0hS\W'wy?R3N"@!"g' i82Uwv$2#ԧdNTNզG D@mRf  |`DB2iCnQCfw0џ&ɩR-?<IM]u]'~`Ik޴D'maH`/WcrfmS &t~?`9W~r@eYT#8ꆉC1p\\ljr~A|GFѩlU@w@!;SR^̖SӉ?o,WX%{H]E} i6e=Km/). _kG]Դ=X$Crݡ;D"U 49I0ֺ=cK_q\$p;AM{5 ϒ/ֹ#w{tWku IH6c`F0I3iv܄oU^[iLx5rŊO1r{1IoatnQ"MDsWsl^f/`FN2j>4^\ gkyO׈}zЏ pH(+D,!H`fD=b{)`+P2rv ͹IX莐=,7UJ,r$"MJDAe_ages+ҭ'#6NmueP}k ؊T"%Z R/7L|(Ӽ1\/ r?@R:u;do">ŠlѼZ[x$wI7M)W[En -51,Q*E@ƬIXMoJTxGÏ"`W=K`o*y/' `]N% ^ LXW`asK/1!3SJ;NU^KdF)Y:x{Dqj2%FTRH8\{BX{ POWꥠoЙpwI+bȅ_S S4G㷤xyvg၏XYc1Pnτn#[J A|W;83F;844objCIx} 5pc9ZbȎ#C :)|0GIpjY픴B-Ly80l> <[j.ܴ]?mVTk0**/\,Q e_~|giB4I̫V.zY4kÈ>z@&y,M\; %z"SŒ\[XvMB:& 2ޜESZf:⽵.H]I38s {2\dV!c.KQqqkY#G[A/g&lx$33|m/?wZN A߉$0`綪Q%z ^^mTUSC0{6r5Y( *8R2s]:Q|WY5RJwʖKNBDw^P;K>9IdFH~?f@:! >D^j܋-b~u|"R-Prj#5Tчb&OVMr[KڅhrVN[y,"/&RCDW|h}}WA XNkĄXi9us0st5D *(v7cd c|/7zM{W';$v,vYeI|1J ߩ-l2 `mTx r:rh%"8⏄gb+aVz؁ZԞV7]vU%؂[׋YNE D-! 0i .Y>u=YHaNu tmqNm"|K־ aQP,I97CV >ehfk9qu5 c}Y)1F{hߔweLI[IIt{l]>,f[m3зiOdgv4IV;k&VT|;3z7@K7?9MQ_Q':eYV݊]0Y k~_aC`0 t١q38fc(nImwU tpc ~/m- 4ҿ%T^w1zdnhN†X(=i _Wf{mn{PCE9! F, 'o_HȉgA%B.RkaמTfZcVowHk+}'h, E{mM5ŽW]e!}2  nN-e, /gm,5Z;zVޜS ,faӪUŵzqTގ"SMIOsழ˿nx*T-ԥ5o|sv|lRUPizW@6Uq@|D'@[~ׅ e.dSuWhXEi>ڀAq<c@cYtT& ɲq),6}8EM$"5}GR .5Ѧt@k>kڿm; ^٨! )>Ў EC~( @)ݤ \C![fJxlѿfژAZ{~[k4d ^g^CLG:Vk=2; +_j ,!1'NV(nw/!/}@K!w*ͧ& Q% ђs6YdY;v{l$f>"<$M|Q=I㗂ǥQo RAMDd/f2YoA_b㳬pVPQo@@ !:{PK.sبk톱4 x)p`W>Q8X"c Sm6 CݺزyV-9MY uA|'0KIeP7 \͜B;f9 g/dNLǒV`;/V8>%,$d1 L x>&~& T@e;[H1 WO™PT3t4Hq߭R&D'їHs} v, [xOpA.e%MܧI折0C-fٯ-XBM8$ƖeK0d8!M;,^*Ko FDp *7}[atbg"6ԬrX9>7KJRi4Ȩ` I)$-Iz*HzU9lkG80`|$^sEۋom|8g5yF7 dJ-$SPERܤuV wPUmE8ftXh0 sgFei_ ygYi$j;_S֨˗l!]᪘hl|iiDrL=E-N3Ҿf~oDQà'IQtJ”3̓!J G0pBb@u^}pچj==/c\^_mo3+@}D҆_gO"v6Zn8V"BB) o&ͩ >XLlUB۷i"oتD*?xWl 4㚝DQXof_3F佈!p.T7%id~9\RinU>q χ|= %AZ$7+CB]|6ǖV-E7*lV/Xh'6fZG\7bOO Nu=cĩ]/'$n"k܃-T)`LJ󌅋B.U_bE9+zz8͜~c~PCßs7TvdQz>; a !+:F:,썌Jmki**%bI!qNL>)U;AGaPHx7#jpی)a(#s{3j?u tt<ߢ6h\~vJi1B_|l1՟=i;BQ|_)wzݾI2U%eqIn!^'T26TS}V! (bс(XJ7l2-h8~{u+)=hiGq^)1|“a<=zK0_iB'w/pW(互*~v"NU,sԚJM}-%]L:EƈIZO59  i.9n@]ڑfѭK=2Qui=FjçiD^̃e#mƑqtG-CctA B8L@9Q0sunG3)鋶21OW*kQwA "d}O&o! CJ1t{@; +[)W|tZƥ8 nYC#l|}s4WZ8}5]x{*vxTV"~~JxܬBv!_gct4l9g2›QXNB1fX)^iq@E1*NS= Aߥ*^ćcn)AA5!d)R+$C; WG<_S'ˉ)Y_2,tRe>0CrP `hiه׌i$mvB&Fe`m@Uqb<\QR ,>j&1;?ٶ$ 2Ƽ__4ThN-5;}toዯ̂pƉ<7p b{ kU2_Ҙcq~Ƕ3bq0[n JiJŝ~ d-fn3ԞmVSɳ9x(*1Ai PMW  57zK7|$=(iv5&Ϸg (&PKL yL6sy΁@ccw౑-[zڣG|LEHDĿ N#X)DL\EYY58&i@e%V Wqf'c H22xTLu8%-C?\uHAGշ e1z*e8-h?ي,*-Ba&d;) p.:'@9sRuL":;7%r`T$hAt"CRD}mNlW {O~|T7Dr s0*9%!Dz':O"wUdFa?FJn+Yu+PΛE~T:_lQ[)G?ÿ$8"-DW8џ$̧d6x6mo/:uG7V[ VwVi4NՂeF=&m˜y=&Ϸt1(f gliv, P=6l!VBfP{d_sP_<tѩ8e'S ӧPP"GZq α_Fq0-X4t+̪>˥c͸') 0׼O@=k+'탧+ u O"CK8_7;A ˓H3rJ؝|]!Dv\P6D|3iw_ԧR 4'ښ8Pf4E\n-xI62X @2w^2E(0Z؇ά%l9(@k"bQiDiz7poCz; >fNVQb@7:Ƙa%ކ]餪lW>K8kQg ۖsdawm0r?0^Om G&FB:gദ~ dX8 V%oI44=a<; gpEͤDyo o6 J{rssn5$,&OLi^\q= ݰ̔P¯vBVoN_zΈ39ʽ. D@OeH]QخQ"݅U5 eg|hZU=gUls U_}\L^sw9]u_FxhJ*8Eާv| 1Q;x$<`[>Tʋ;ɢmz#)KD^6AJ!{A J>~z_r lᆚ?h:Vz5K F1xJnA A*Jq yM^@Ry5:?D2rma^D K~8;B#=iT\qrBI~{o B<ͬ=ЌȨ(6_zV2LC?Jx9v"Y4U*2Ml؊H_ H04V$:xi;mH7 ϗ ^D10Uq_Mt~$,ۣwJ&9}` lQVhM"=ra06%lC" "h_&٣Z6|Ug([t\`QS6Կ^h.ۙ,5Z`9vۼ"c`Lx)VZ㸇aJzVю@}&Wh h`d K6j &c~7\Ni|qtxvIiކ;.ZJъ#.XO dMcȮx/%:8\P(E2!7 ‡b<+3q7<ޣvef/&aR_  a#m@9 QE"6>rD?RU_r5+Tտ8JD6wxN6h&(r2&0J8$ih U0w/o8X @u(&ҝ.8Dao9wp`ox%z_ܸDqdbp@S/#=z< 4eic b4SvnO z޼b aߙk3e5|3`/ VVYb< *`1ZZ Ku4 %@at&3-. X':Enنs5ugyN6]+]g ާd⿯[!Nifg=SYl &w׸6 /->Xf]ݢ8T` .E?$ʴSjF9P IesFڈa"iy~k_,G2ONɊz`3wn:抈}ХlL5DS ôAݨ &4/~OU&Y E4fZ]AUc,HkT#ܻB0ᡗ3q1)l# UY@Qi.!_EG>u[po21C?* &8PYfC71H[qi!ҿiiW +Ut1lNlp"&eX4Q)d&\X83ٺ^EԾ5cp󗉋(X4 _~%p&Sip 4OZvWaTO)nB%2ZNq7GuWh-aԏ<>d݂G0pGSOc ;>{KoDFLE0T?wL 0{:64Ugؑn"w{=m/aj)6d9qWÁX֯elZh7Eam6 QSY-$GfYO$mER/"I([lH~+*7&Hq )LIW`~~A70% SqEn@Y&nTm?ܠNB 9a>pFU gq:8.˓gcnWw #P-.5"b[2Ή:i,&ڷh_u׺zK 2Cҍ?MH2xLVLB@k&;H_8,XL$i_[U3̃Tœ-1kYW-Vᱮ3sPTAQJXU|Xc)D,;ȓ̀!)>j?<I- #<G_y#d $C;8dAF!e+'yg"j5:q^:!_ 8nƍ. !*b,7v rA8_ 0mnAF S\(e-~O[PZpv^9º!pAzUƗ%5]i(s(:X{c~~]/B~.B_Y] qufeH Aёj.`ha<榖YD=Ű<ޯUeS׹?z(r]_QBhԡ]BtVALӺ6̝1KKw[E;ݾ](G!`(YϞaZszvr0F#$v3#7) .^Λ}65[HF`RETq~0h/A5psBw^·*vBbw+E`O_`9)Aٯ d1B+U.Z_߽&E`;a 7hV 9A:>7ZD`?#>̩kl7ڮ^[S-Xԋq9ϙA_"ƶM8_ &%I!S-JpVg3p!Zn.zua֐瘔BHokQyU#z5v8+y|Z@<@I<ǵ:GEw]9Z>rnےҰB*iשJq ͹{ހ.w8lD|\5S) NdfsΎh_h?#~*+jkGH3E$eu-vǨ+'!yziaͻ<mVc 8@2)pֻH,=!>z27k:I'h@IJ:ᨄC-st04B,T<RzJno#`e87|,ym%pZՀgMhIB92ZmkL ަD1os 7rfS]q:`%u;f e(q +G؎IsY5=Y{TJI+,Q7K|.K2IdN7<22%8NP1(ed/:zzsөj[.˔9IN(e"c'oGqS%B|Nh ldG.p~uC3ah|sE:BC(anaK 0K `Du$K&1c eY=&MӌlFyc}sũ^'T}#WG[t}lv鮂>YGn.0)aioF)6f#2(H]bף-V("rlB)R/al;+3U4^QNsTX3&`cP-QYd&JC[mFyO+rjˎt ғr/%#; ;#vl×thrrH:+Y"=V8yo(}I}xoj  Lj|NbHC ך% .m<`ӣҳgZ≔AmϢn{l"bl֤;tVM y]~* iS0 y=\#4ܡGqV4+5BnGQLTPP:]aA!M)FV/3|7խwB!_%UzjP , ,TSb% q癒-1fjY~ ى&~+69p."D 7#*'}4TjآA3%[5=yq}x~h"X\HKͫjν3)L΁KF9y0 oo4VD SЦ_L=LIۅ FAG|q̖?_!S!lYhVs/*ߣeXK&gPlYsT_c0Z [u˧hjiMNܔ=~/7=q[j<2XF XvaN~VI?Hy\ }_v62\S8ĘIǩQܧ4ܻMYZ4(r/!p gT W5Ltag+\U)LOJAl ׿)E0uDm>76jء( ^hS?6vyɨN'斐.ȱ#"&(2 sޭY˚}#S?؎*@pRZiY]%>ĦGm@6kZS~)v&6=&}V7JɊk=9r`Cϡ%;(X56KBI2$D}ugTOan-X) nea[hpSdmCG?ƢۼyNjm9 YDFUiSJ4Q``TC^0!2~iN_W4|_G}e|(# h6 q.'iɔ.E;E/#E'@"gM_暼sڦ+GAyaF5ٻ5h Q9J74Ů&IIam:C*&<%A!f%jګa}ݼt5+R9V <*eÇQ90:!XEDW|[e.L)aTxiikaf .ifVT9*-fԟ/ _@?6a77Ud@Y/4mZPgW"]O<{tv #6,b{{Esj + -C v k(h ٞpfUO{Wwݝd lUjx J =z+Pma)OrnUUd74@"-$h#~0&`aKu tgZWB˽&V1dώ:=)/ħ+q~? P_8ᒅWW3Z{5PruPRp&JL;v2& &ހr[)dbm^!Zt2nQ'SΊk^?Zsj9d-]g34f[FpjX+f^yꊜM,̷l7x#`sqP] rX~ҹAF(M-7]L@825yHlqBڑc Z* b>}gHjY-]G\Q`an|/2a~q;1`2N#G{E^A?l z/6uʫ$r7*3 2`}WOLfɜŽNۤD|zhJ k@xLt(+_hqNk`)ɊA0k=\1/DLjV<-fi!h2FBoە]2atuS| =#ޏmdD :L$ %&KCV3T׍3|'H &6,ψD}nZĜwFkz6 prI r9 U'ĉŦF!OibY#bio[sup >;GK1- j?Ō+J zpA}i:kZٶ)gȯky">#ʏt0 kqܟH&`*}->;ܕ|HyCfs2ϤT+_S]kkٙg׬5W+* Z9epR & nṺcv(2+C!f2~<$h`^ (Pla/bB S]/xLsJ4w1)t+ 9$ˊhwaE.D-SD„73i6ZoS`XaA֞)s02\}OpNol@zW]7بDjhP~x(M( EA_,9NZz` ~;><)lBſ-<9K~CN-;DUk^O#* xH.0=5k^mT} 4.U2+yoiȝVrN=B^tK9z'+u_) -*&K 65&b·+qd2ycs(jYn9{Q7(yk<9iF|wVJ-֫UQ<0/T, mX$]:KɼVvPMP !~?1V\uNb=Sܸ "&hD_sX@ 4ʋiR(R? yD_' a`UDj]Z 2TxorFN6;9 mYnڊ"He:ٰOUIU0W10tc+D,)R珡"HsH!^(TpcmqMKfgr1bx"D2Ճ\z[4fD3z~ X ?g}4yA3yS:&/<_ϙO#'M^|w5! [/JICB -$ 2HINME%T!4M6u^fXL$?j,ErGCq_/M%+\352W g2J/5pau ߿;Su?J +EM.C 9\TGV7PT8u-?Ղ!`h;"܈u}U$=qc(R+NNSύ淮wFʢbh)w"EvO"䑏#SCH罏UV=d卿Rb#iv|bl q;[4`(H%bxya=̠ޅ"}>7K7ϙ|ÿnb?ëMJƻ둎A@ÓgpFj#fdd+FkwCP%#|A ZGݢO{MPINDZ4G(g н5!=@~pfW|gzW?Se=`$CBT6v+ĭvIlԛ<+e&((Tڈtk4|;4An^ 9tm,tߧ5TJ[zٛʴ"}W(ɫDsL-L0CĒvƍI^r [Pv>#5{ވd~jp n,&N"a)͗I'p1)i&Ѹ,a'AӁAE#[A|37?U"<)MYJR+%rtõ "zr-Cg)ݲ@cELMjחFUf}C䆳{7:'[2xG $-TLM c3DT3<g#;yyMUf$ڂBSoM}B/J~.bwU-B7uOI{)3)ݵk䲤pH/Y'BG.o㫵27kaމNIo8X4dTL4EI4:âD1W\! B^k#48(y֋>M0+iּHg?V 2O.hKWn !N,R~dqRW ͞X1ɝ-Lk e #ƚ1 $+gM(ʪ,gGnZ.,]\ ;SxV՞vطo{[ڵ\"ؘ9J [;_7=3D+(ubCV ۣ z@UTuxu-cC ڨ$l>_)R(k K#TS闡/ ?y`ͷ{*NlH~j*MUXL?C?Δ(PaZWB[b`ksbƭMt;%E|1Sʷ<e(ar%[Fez1fD-[͒&(6 =e("K8^=AswS"ȋb2#؏/Dc' 3\=J|SZkпy;ўyЙ`J$Xax$ ڪ\8nztc=5AnVkeYI/K⽁º@wq.E'GgO㍘='EeP@b.Zv$~$jF2ϭ=VdDQN4D4K\K*H1{nUj Dc1Qhze2wL "H`y-Oj tDX䜖đKaNM *@z8;y pVhRu$KAⲷ=.$tV CO+SYs-88KDhGA^#>S-j};8cVxL JK0Վk 5H,6d&g; )C Z Ysܚ'0JxG!̔lKaZV2sҤnҴEe#`2NA84Om1NlSj-S |%ٌD22HX^O>k>;w|XV[A}g>7 x~jũj* Q\Wb+lhhLqd( -jQ;b>^DJ/v0J,^ÙEK"KV^$SE)+=?ϭ:bjxkQ:aq4GXuoޚG6mLٱ(" p̿K츆.VbB] VugźJiY*Z4`4du>4&Dhͥ]GL$6/^~[8vI}ʈ9vc;t{_6 j/TaargO_WEgfpfs<̙2EW('Ŷ2&}u" ('^Zu#  P1Gv/O:%"hɒ5u'ΒHV) =&)д_@ Ȭ6K[vVN7axd!5F>U~+.N뀇33eN8w"HZ_ˊR\g@c{!ҕ j/8{$Y$-?hdL 3׬^gP05(Fȫm @+|N%7o_;Jie|4KSe=3HYϧH񝼎\Rѷ {7C e u#3{6D:?/9ԢklHݹ|B'CkF$Y5B!?$ i`M/KqdVr0P0o8!N0`BI?R1̓Nh[<`+)Da30ׯx %zr9^c6 C)Qcpggi8KdKI->Cv Ŝ.zLϕH(!tN ~+\ < A{5Jv/U1=h@c+e%L;J)p}w+lJ5Tj6B2vGu]W m˙m+ķ1ɸ A9$[Ίޏ7eh>[ЯB%|_x STxuIj@"aG-B@G@3g=s xҐᓀhtbR?435O^z"2; ekm[ZQ%3]JRvO-_.+`* zuσo~QT-YiT7 |Tru =|OB^I7@Du8"z*mF<)FaZ{o[ ٱ E<3xe.%%4*O,4EKp?%T Qni)e U=FYUqT`EQ;>'/0+ULB:h.GU:3GZOZ9/C]Xyz2_Lű + ȊLnIVꝥe9X\$n̋usY?O~M9~_$x`ooi&,'3EGB"b:eз5Ej8|8rL|Di+xwB'@pGl}=G"]aqk_(?R*-*1u҉Bāxуc}ao';y"` OuxNKB@̑{f 3bWt˽;YQJ.qۨ =/"vfRz}piض ?eij mWp%KHc{3E4|/凸KGVJ+`% QN4 +h]$,¯^~ VSDG" ) )ks^r8Qp ?ˊ{F/*"{0udRb1P1ElX n%yh*B$ D,0׏i{UQzq ĪseOzffq\&4&3R6̱uHQYO!owSHG.@/ܹBb=(1xsjKYV<|䤂|lĵJ5u1 *6>ЯNe@ 3Pq(!2DRZ!Yd;s}$[Eʒr|#Pg@9`3Z~v$!}:veɓ-ODhBhųAV>ȘuKmQENB5H1ۨ'mTxIx.'DQoj74֋m3 ?Zʗp5IHzXn.aߘhWJzt[{tݲq-e䘧b6g$wFQPq[k-G뇎 :"'ӄ(#;IO1دb3]cئjY pcn?.2k$c[X>;Oz60 ͞w!O+>~o^z~? Ll05iNʲ\1\,,ۃB(^:Nccv?fwCh_j!(${[8g&t9Z$YϪ# aB5R bqs4E68+iqzq6l !RK pfzSvSz6,ڎ$\N+8w^bk 2%ɊQ|[ d}wdžQ`\/+)LY-{ZKW$jAJa|Hs^$OR:'C￣##s8'X~8Ԥp֬eNض .zY W3!;R5]aV0m-RгkDOp^TiA Z!!3*U]gφcLSmW$Ao(QwݡG;^&?ikdn^-Ҩh^딣-w!$F;~98K:Qu8[Щؼ#f@{X| J(ryggfViHXWQʈAN(ݳQ88>ufTZpf rB0g1t@, XeBAR7:s#ʁD,-! 83X0%΀~n7 +DA,ts<ջNjءlHB5410FY)42^&T;V93P.]KߙG+K]\Irš?]8'= Bt|FK3;`D[hvmN# ߺP?.k*R:1;q!첥줸&?x'Q/H{JvW!P;6L;_N+@+T]]Zؼm rʁO=BD pFYRtnYqY}RQ!AwtN+!5̝խmO?41ꊙ Ũ^+4$5w?<PU6Retm/T} <1(n 3jfIA5Xדic9qSRj"q!-/)a!$w/a#YZyTepoYv=nPP)u[?xHNJʰ?xYyD)E%19D6#Ƚ/\w=GE17CMpǙb*$y߫oYވbDkET>||Lx 9~6n?JbMr a=kay(zXƨF_1F[P.-КVSN@ϊ@XzEi*d?<0e@}FpjNü%[{`vBz%KiŪW<̢WY*pQtB#$( RmD֔"+֝M(q6}'@4wWN-/ TYsIt^_|[Gsɏ4㞇 vBTPMJ9AAo9V!ȴ en}ҭ Kyf N]B(r_~jCuu{Ko.T5 +OvtnRp\3?S `1 E`+~g1CzaZRa>DC.2N23՛$c~P e $ PEyuG1GS|$A `ݔUTbD̠KN]ʶ9I`^Q¯ۖh%3Gk+v8g!|qk ltNWdG~=<:>!oj?zOg& &CP`8{71[!bU:%e i6|xT3϶s<PխP?m(2csChigB]qH4?yh.SA L^?"!A]Oze͹X!/;@ѬN}j'Gv!0zV9#Egs|0WN(<$47Rwoհ}`w^o%? 8ouޓ,%-ϭ9)HlrQʟC.t=cY w39;svvHlk:ΥotB"= 1=eĀW5όjj;49`Phz)8K'Ըs]J!8@5T4kQrAᔜa{D$im9Li$+ϰ7GMK3)Ov]Lٚ<"1:L$pxIcяaV[3Ve2ΒYɰ 'WSN2M ̷ԫ0@$A;ڛ{Xԇdk(r)hTh%>qKL݌UЈ7FRKMܩz!S9\^AWu!{X}ԸqT*EI$Mۈhf슨df+zDk# "BSϗ sZK[¶Y0EInScʠF]NdW~Y j;>0O|.Ehr^xj36dڂIZ9?j{Gn׏4D;<(S9Va ;n,/U S}FMؓX9٤X:TBxϖldxǥ-Lc~VyY@" 8eē_xߏRUz EwR HY夠 /g<:2k91Uݕ-2@Z/_hFeK Q帡7PZ^.݄jEjgjwyoេgw |P^]&VC>xN6Y+_% %:;T5e$5ǸBV;rYc77_ 1NCYWz }]Z =T3p1]J+GFHS2wQ}eXҏb`͈ `"6gP0P˃8>= ޞbㅌlQ L~c(>b|z; ;fC\"͆ 2L' |8tmөs|?i53K([t#x`'lϮZI*Fh_%U.=SkbEŔ:>s}g5[y6EJvTnxE9"TG*}"z/qH6љbCCq&Nn8nb&I?XE-T}Mݲ&]T%oaIZE>A~xC뜃I ,%6X ix6_!'绽[GV|sv+%XD{zZUZU +sJk*Ih/shL>ܽ=b$އ:?w,ksx ZS>'s%D |" !e!(H-dxȯ0#q&u'[#."/'Et}X]ؔ+BT?o_㘺5PrTld*}/f!&Ki03qrE|j<+iA6lv?ɆAG,4*y,Tj(‹Zq 0rW@ERrե b=J¾5`'U>49pBhOc f9.hw70B.LaI_a`Fqv*ǼD-'Bɜ751EǏçyorolWSqߪ) Jfw痃S SKq6a0%1gC[ט178"Vci!:HݝjK` dbC,bqtZ\oDwT&GkEL5;;?;+1UdbCP D";(6E5WEE38ąƻVaݩ^ĸ)L_ &v/DbyH6]@gL8QfIxO#u$i~sbpͦyN4BJvڦdHFrGl;@ 7~VB1&orR |̔iT>:smr7أFlW\=4-jXlxNUV݉>8r܃n8UO} {bg0tG)IToL/uX+^(O窏!++e&qhf`Orf|bJ SټQ5e}TXރ+2pLj5左;**Q܄!>6@qac@_fo{ACxn4C  &s|=,#+D(+e@Sc3+,nu*S gd"6{־4&eT?IVY'N_lW!6lµ>h-| #ȄDsFIrT2nHCm1k yko]h<JK󵌼G"DDd m#L<2fK0~g(CdMC3Ux3 ѿ$q"%ڟZSA(fB'b2NXLjnD{&p.ե T+JKbߨ2k˅4`A|WMDKl-- *z n:Z?'="0WFX|}ƒf #Yh+ ZHu^Rol6GYq >:pn;J IV- R++ժ=IM0=38ZY;@Dޅ0,!2¾`k8m ߒa}~+ lxm I)VZ;q}CWRc $'H:deeg%"&1rk5L`|(x?]525ѳ8TL3l65KexQd 齄0*MB@sˉCSzҴB{hVVMؽ0ued(J"ɿC(BnS=s8A5uvˤqUӾ6 .%2\ώpb2tkgꥏvswxBb$Y=EOSIb4u/( 0:9.:('eќLoVe [FgMgRfGFZ2ҎLj@aӣ=]>K7FdFLWO+9E6YvDn%<JB\O5 '\!.^dC[^b?W}j᳦BiLoS쐒V'2\}"#!/V;r&zu8~q-}FMDM ҇y"+~G*IeE'McԈwn2[sL9Kpn^o8x<_7$D {dR<8&ğ+K=Op_c랕}| Oi*7؎G7ՠC^F<|KرJxk\eJa.n݃t4$Lϝ- ^X#y}{cܔ,08+~L2zx3Hppi;5 u~ gv8.rH,u\>/RLe|w'-7K mz7e(z /x,RWg񼱕)>'yn(xzX[Xul:te| lG5nS *+Ahiʰ^ʂ//BG-PKu P lg\" ltKbf)*L#xՠnEWJЃ\srgܡ 2Zz( (k<@d/rT)k:Pj0.Àq䆼wdie|ABYz4g%T:1}üxpJ-~[G,`5 ~}4 z_HCٻ.޶\nBJG$b䲷4B@ҏx 1*}Ѓ޿Ix;w\iGP,iR)މI{kΣ}ߔaٰ>OO3&8ajZ{ab=Vm8d(δbd<`rJILh` ]qn]S6֑>ڲS^Xԓ/Vc_ A%gLյ1 ۴tNχO=Q$mZ f8 ZC=RF=-2OA{#X$>Ӻ\pH7;]K|o Y '#uJc9_dF8.l1~wFb \xNR3h(2 HVBo_tKwwud["/ł!|+ dPw lxGj&g5ᱫ;C^k"`aC"A;K8Pn ܻ`' M(>z9Hljt&ʆWeɒFq"&iG70tr:.~ҟ=)L4l! \3!y qkto@-QggJk+g9pSs FrT`@ -Ax&uQƇݕ-hZZCx}іLJ ZXUnbzXTI\^J%l~#ٮQ92'Ov\U,ޱ97`Z[9ds:Txt5:g?<7i]veu3]ՠE;%>ci>=86+p࢑fq;{dbyJ0eiRk_&P]u> _?f:NĖua9&7N v2cT5`*ǒWuKMtrHK6= %&* V-BE9r#G--̴Tg>+wTeq+qa&j`ndyzWXoV2\s"o+7<_#^0rFtmhd&m. $.Ͷ]`ݶ&jmNqA" Jn %f2˖f;`N?0 7tYn}!ɗ1M3=Ҵ4antGu(pG1hQ}퍎5v bk<]:C4h렀̍z[;s7;RQasD(Ԡ"| !TeZa[n]_{gj !DtFYfR 9U o3"'JYJ(ts62 fW15jzկS _T1u703lg5T@/@ )㈓`ĿMMj00z(@GܵobMAm?]ì[ր#DꙎx2=2q^'JWhVv8$  #/hSΤDѾV3Q':QJfަH5 s<%=pVk^BQ>씴oG^ܩmGe(V[J}&Y-):%I~\%=ZG԰ZBr4MmSb8t:)+Y<%TcT u(6tqALA,Y}֜)tNug<Z)_է{wV} 5@8F50@uq#]n_4~ ,""'z`5xL({L2"Dë=\?^"NXP^,/^S= l7KMWwfzSzKBI?̰൉oJ7Six;9_(HIAX<ŔfHk L=@)\L%i( `7nb5e49])}E3JxbX F~X2ϐD0 K7&K,%xm@2>B4Z7U_s&ê>ۿKR_P^zL{7oK!f } <4_GTNyH7ȗX-JDcwN$J*ZV8X _?VMBBn/r@7euYt&^$9 F(KQ=M̒VT6DS2Z(jtMĜ\ y.q'[rdSN,|1z^p#N.26okq_TC`Z:2S aFxDCN}|sjxz>g{xxG:M)s0-@G!,^ZA2t]Dƛ:_roE> S1Ќk\W8ZbHBWshYCpR{ =|,5WW/¬{rs;J_(|AE;,ȦKc*J?SY=.dBfeN->D]d7mqRMVa۩_;;Y2]熎?f6 6ү4V aFjV:VQlTH&;MTk!B;uM3m%]U[^1@ϥ-^On9e!0;j. yJϑ/E6:ߤ::m0H);OT -90~@d] =#V9-w(v4ͱ\xJ$ت# Oc' @qX._#1#wH~% >>{6 ?چ $'%iŒ_OKծ_q3/BjG,uI*W |>jaHaБ}cc`cfFܭY}hi0;eNncl;Ī7 &jmJb{5_9k)YAz%ǰ|#H >_h+jH pkEmcR٪Y7p} 礍t/8PB W7` :cT7pKwc[(s ` ]%;eF~&1j̶VU*_qpBE M úc 7+q{&7DR ,s&J+E9'-%+sNu,^Ȟ<fpAKVꐯc:9`Q$T"4+߳A3klZW vS8cދ |үON8iuj|XCwRlWSf̓u4W.z}NgHKY)6yuoA6l9G D'h5pT.2y>Ԋ2LUN1'E]E"z)+aP6@X:-ٷYX tytٟdngwbY{#5$Q;{,0$;Pv+5;5gjɤaUq{ fĽ֠7Y'C)>0c/$oX ɶG;T @vGo|#&E i= *C]OWhB<i=3 #;LEW*f=c Prl6 n# #{mb<~OSaT]JV)qY D ?[nEzSj|,q~/񣝵)n5X'"'gL_\qۨ[tN;HdbzBt?=JK;|"B+=+6\^ .w<Ơԩ p6fsT6鲸U-FhWz!Џ,?J¨y%e^,ntPT&J8m\܀zKvruUST`!lU{]TcN|A/>=B./UT |F]hsHۏ'sxO/{f¹\"M: Uw؈@zȻx֎bpա6q Ĭ*U Zzx8i).fX0cVo-6ރ:dşfIĒ_ 8Yx??xSe}*">c\^O:{Tw@ИEhē>ONZv(z*-vݮ"ՠqlY{GAʮNf\kq Htf$s\j RVMb[c|"ذ_uTh-hPlJ0+wZrbRbsvL뭆vN_zѧlL97 |}K=R#Mg|1`\4XQd Hkf:I*vW֚b+;>aՌ_{ z_DÌ}Io2%Fm[ZvOc ٥X+I{ьu)vihwЎ{pD2X܈zMھ.!0R˳IBǔhMJ>+ºxș( rǷTi6@j3P 6c4eQ G6*;F1w8̃b} 5`ִɅҳbaf\S+<˕AAgC ~oͻ`ֺ&]D;|s*t|Mؚ Ŏavp=lE]GSgv޹۽.dJsvKX[QkYbx:8sZRj7~W1ɾJxy tL T3n_Ul2]Rzrjk4>V pR ̱( v(1չft2컄B:H( beUbHt2`}MNdO1z*j9gȹv&„s%.CT pcciEXSUqrQ3;8hzZ W$RbsP98=5O~YuQuX ZzHfYJPne(|# {?45n/|!tyTTx "(j +zi8{rUkv: /28;IӲC79׼7mYT7ćac]Ǻ^].'&eQup>(Et 8<xWգ wsN'Ƶ#QǟLZM ReX٪SY9UŘ=? ZD`J.,ëԂvԨmG7<zŮ3̡G4H%t}9_?5G UO#I~="T`L3g4g6޿*?(ٗȯ?s{`_[{!WH2>Ls@1`e773g>M LZgnJYg'hHL'hF<a\˜5/Iy[7RlMóU䉰xTWD~oF APqg%mn]CBm$7weZt+dxRg6Lsѡ9n%\^H\W "0j*Z◢Ë]W"gVH(${KVfL EyՑHtCcQVuIKָ:{|ؔߘRcZKC=D'l"jiO~jәEɧu9w./45 20Nv HuW'ndvO+ 7mU'\Bx`6lUJckQ5*>ӏ\4'_Ij]d1DCXĥKzW-N\+z U*D~"bZ( htG2m0!oPAtBC#hF0 cZ68P>^G{A]e>L=`6⪘8E 3#8lgG/8%造a_~ )v(Me1 g1MBM$tFUH+U\WfC^%RM4h[.so-eaY2t( tY1Q}xhTX+ (V<,DA|*-X+NKaXslYVO;yL"N~SS9fjlcD0sᏻ [.:da > 2ٗ.ؑz΁+شWx=Sgscs0zqJMA6w5p&3&gP/zL,"3*(jR cV2 /1sS:Tk9_\<@ρg:i.DB8] x.ygY?|xu-:p+Hn\<'7)k0iDW)S矡ucv>PmH7EXY<(!p SK:j&2pi{ O|[tJFNz]tݢ2FH|RyTJji*^^WC WZZ@ 9$}G.KjQ涊"ݝKj!˭UR[F=L3NBdqyNdFTl dWw^YkjZ[h&>7vc*QqF[3$!)kv0 6Vy?^Q&IJLI_ %l"oA+L3h#gQljGMTN~9,Þbjw3q35t9Mc1i97@a3/@/=ݱDpOb0Ɯ]8q= XT(JށFs&Iq0J9[y[X>2O TaW?^ JyACXLuÄG}uUcr>dCl_IՠD,Sv4%=. D7&yE_i1A;aw拓ҟ@!ߥ]wJεjYk2#ғ[l4;'ɣ35*d5Xm+)gনT܄n] ^M}ֽُ}s[sFe{8*cM @IEg""eMĥUuXdl X;!CǥH?{.[ʭnfܹO>ښY'B5%z* !J?X@|JSj8Dq6.RD!w`鰒 β7tR3G6t c (C<*4ȠZJ+*+;Z[˘tJ%5=Jy=Wܾ S݋n@n W.3SmOMO,j]^lVeYzl34+@8ٸPL}=gI2Y$Hh-BuPeوUAM[ĠbW(SՉybmZ{j JZTLs'do0(hh@}hҹPHʠtty kKP-uuH!G G>>}2I=1H7w-(kۆ;*D tNDP%]($n>wEa򶗀@eg^RojyQ`8R.cLQy ƟRZDa=S9)lh P=#σnkX2hV*3ģ<_=:!RKGAf&l~ۑNv˵*!ϱoeBO#7 Bu?Uc݉ C{L:nIԖ9](t.Q^h滸*J^&*d_y̨L%y?3]^OЕjLcnuBu.O&w:QB\ X~-˰[ bՑ;jėaW iu0$-TJb\vxQO$ 7 ; oɰVeWxSO WUg WXlLV4}k9.2X("bp/Bmu5%WO;z>p нHN AKoR'~VHƞxPvZ,q̽L(jLAzW @};t`A(!~N?fUs)іDNPQFl{{m3^jr'#5,L EO37尅Cmd{.r$E溨LPr#-^>,{),rQO8F_Fb0݉s5ʹUXcqkpZoqFm|Mu}2K@eS-Dw vZN$U<$q9zZVa%z4p-. cL+FŘxx3BP+`f N\ 9ٰ㤹m|+= P ڻ)#vbj qմ-A.ӧ,i^Qwle)>I; z{`B~cfjصRLzU K6i;oЮjqz9 M`pӓAXA-zF΂?_|>;7M/~[clt;*XI ǟ#%8h jWdneK /+$%򳔐x˝Ӕ+35gʨ}E+F%`_vcNX NKGvڽןnUPbUO]Yl]n9c{|P{D@5taRT|/\h9ouz}G̥0p8<{~l#ht!ހwͿ7/3oO޴8l Cя'00Ӵ1T>*)lwE8^I◇*F"}z")=1zS{\iK#R= ou{""{/84u8>>pz@xW!jⵢuK9=3~MMFUW~qV#&#*ep)Ayq:,Voc;>?d^ḎGgڀ׎>#<]'V^dOJp U18'C yfјšZ Z<[uvi "A@Ӵn?W-qΥ]^ X?Iû##IRV~7@pmٵびܨp|RMgWq!}'ݟ<={lRW>0,{e} ŭHd}>/hLG5_L/f4]UzJQMJ Ɓ'YȨ4}*i(,jE4\b{OC&e خհtE{@tiA/nM{}z@׉T !QTzA 'fa8j(d4vF&2ʣDlΞ'B[8m8Nď).)-FuKj2dɏ} \^#"$߱Sz#ĸIxR\z7& Ss%ز+Z!ۄv-; bţk; Z#f7D4hYڮtW z1YTirQ(V5*GeVVށ>\͇%0CDM[_#.2jȱ`49"%% EOV[fk$dQç9i%a=ޘ+rJ4 E6r2VCS(ݳ(]ӹp#L~*W.L7F}d'!~`R㙡jˌwBJCdaAڰGAEj|%%:ΕR]<+r_wϤ)%d*pa6~8(Dz_KS+:&oU5ASG-6B${>&eU m'H$8g`ƶ6JS)ݽ\(Ao)cő٨ l~-6|8Ɯ<цwAݻ^k:ʈLYjQ76 45r4bRJ W-7kZCq*{HGba6g{EHremxz #'k.`BLj&＀=iogKGH?&4ܽ³k՟Vb'Kra:/OunT/xHnsc=j-k7LJw iTRvĪ^5@XjY%]n{`s -GۋVS,8AXfA3[^/scڴZYDcZ((h4\ۃm` Z:3)*|S>_y$7qql) $|'\>UNOQWB32u}ڷ-_ !3ia.F07j'㛨F _T|I@KXį%cZT{ :k!1/Qо|YwT|bx7t抍 $vR}Nπi^1jxUl cxsr2> U$jve%mn ^Yu\( :Wk6\X4i|mqDwtTxsL˻|ovZ7Cȱ3(Hk 3iMoEjrtKp#B/rTjl j g k $ ߭GOA2*N2I{d[6sI=Ķ~ݪnKAjTih6L+;m'^%-LbeM^/AN-ajNҁ2AƨP2Ӟk}L"݅asʈ2%{fzm::$ata0cmGp b?v ˷'gcƳ1Ml3-Ӧ CU[tޝkamcZe (p/dN=,C1Qߔvt"'ڽ>6 "jP2Ѯ %r_vZvT!yc ,¯6mA!(߬? \X̷g ?\QnV;M.죹Gjstev=OodTOዧ Lj{+DkC;:Ud䙞( ~|D#.*QɴlgP^}QKnpMZ dbNW^9ڱLr%c]&KeZ "u'rf}`yBN|@}YQы7%': P}bVb,<;.Kރx IjNw,'RN*yvKTc}9 3h>4sPEV2 RJ4uH-}ClzbAQvY: 0WTnltInn0Eyi3 jgGT"V6ڟ/Bi 9h~){ (täΘ {>!r*5LMڌ܅QƄN  f,!hW'f!䖵o%򍂹2>uu-xg@FxN?6=VS7sj$j p5Cl^&,PW\Miٜ09:MZwV;69~ ՜Ph FtmjR=5G~7T@tܣZ!.g͏f1GJz5VWJ`pqR +d>eM|P)S-4i]?jxaMOYTe8](B2D ,*Ez %N7I{G{ЂѫMtmm*6˩$ꊆngt>}'xEϔT#Z]+ozƝ|Q"x1&B0gpf&ڭJX2]%(mYT.ňMf8>⠩RSr8AU?şq𯮯*yX3~+ +3yEIǓ$A9 XC b&aĕL|u&  P*:$w@=4MIAb3SbGEM~ISz+𯁱 Jzj@<4HW,| S};+br#y,fi);ֶG%=S%GyhjzPB&F)z TJk0H~J x.ázn|3m 4wXẒ[ALXVvv.QyhcLd2n?؜ܪ ovgm9u NυAcWcc\:C x}S0D$~ZI.9EM쑈_z?hxp <殌JJW#}~UsoHzISu<{/p[`41FFR|S4֤&RE!l'\]3B :F5 VJ Lжce;wk!:[!$3T6{;0+i9+@fԊVp h yۇ⍳O5aq0$iŅj7Yx$M8p,ike#JivFso:h.jq+?|IEFTR"~a+˔{;˜=6v&k\5bY^l#_O?II*"qȮgvg(XW&:09whvAӆZڋLB#6?#+oARC~~˻W/GޑgQ @0֧!8 ~qdQϠ ޶I:BCCNecnE"cO{JǷ@A//q p!?so6'HdW:0Μ|< MkBxj^ZFvbWL/ىt SWҿ<1x5j"r|Z=:X"LktnSv7΀Y j? ΌF) N-k|lrMI}oRmm}%jȫ7RfM0 WL_}rJء|feewm G_ʳ˯4 L ܓm1u Ce[sA d;QEM4=f[=xe@i^![Eez. ƟGH9 wpFש;鄅B#H(i.F$N)=yaa<5&qĂ`t u,~4oDOcۈ(28$e<YH%.nHBd*jf@YEg2;~Uc7(-{ے˶s7;ߦ- (`X1UU#Q4U;t~dDX$P.Mnu#ŹҎ%+Γ#=Pr4o g,9 >#WX_ FOxWFSׅFq*H=-JrOuVйؗLB tI͙xEnf/ݺP?`dq=b9SMm1x j?q.<=+yC5 y-Gq NHc?z15AOcb]¹rm`ʒKjA&ŁնPݥV2]DÇI="|#D=$<R / U LpX8UA-M~ɓtl/n 6Dn ~?ɒ6!frY%ԎO]~@Vbxgu~Y|'^=,Pn~ PJf9\o/{T54 Kw†1[jS f25S(إ79AW=h?z#75;}f㏵3'@~YgM {z|jGRnnhpP-,`Xr[a _ր>@p.NܫĄYC?#z מRS} DRHu6S%SLκ)#-{hCQ}[{)v. ǘ0i!b=fΌ[XQѹt6޸ !}>]XMmu7rfMfku`1S[hؽˢ^i wfǼ_C'J%gaSB(9b_( +^ 0Ϸ&GOmy+y0Eo=urs?О5 øHv繹9ɹ aܕsŠôfVl}!YQǣTE?R=yTF$ԗj5fN.>:yqpE9uDĻ W3x%dĈ0°V@sG7ݲ#(5#q2[c|w N%yԮ? ǰa(tȼU% ؎i)rS^m1$[{2awR~BrmmOD 9LKg9ܒwWEh@dJ+J;7:hX.u|$ZG31w|[&'Ks/ʈ37t˥1μ:ꎁβ>icw?:TDzM\-@Vvjm@-TH u:?%rwbn.AwWt&{aLQ1ȗAlj\M$e"Flr 7!^o޷g>bǗtB;V>_@CQǶat/fPjʪJ%LL#XC16♵xl 1HRߵsSH A*pH_C/Z&],"WlrFWUM?S]#::|]aRjPu 0\9\5 EnTÉم# 5b;8ߚe{ %DSi" $vBR@'Hc=E+ÐD=< ΂k;O%}ّ#\NF^ڃUʲViC0WHhdMrzMHͪ6c$0 J 7Ň)hd52A fljQ8:7b b$j~y3rtH˖ގZ*dLdChϞ,Brgo9us^)J%iɅ`@253vҐ;I"6"ױu˜JtCɊµNo( ?ːCw!)Cn(N p:"03ث )[Ƀ*qt9Gep3&ژYV}7%!v%x̌ m;3 Vpԋ V؂Gyҋ`HlZ˜Or$%cDk͐=B"4ib?8ţ'lyxF0,`AjI\QW'T۲b{J˟8W2(~)R^䔒t<"!vP`(1oQ)pt"L͡3̞䅘w*b׻H;q{2l@aQ Gg giVEQNd3ko/kUf̛z^χ?_ٞ)gjHl`zpaX4*e=\5p"W"Oٙq@7L{"/B~o ?H(`/j椁^B;`X+hɹ6S"FP5:c\/7p7)d,*FIKd(Dɒ3Q4~J[Ad{N5bIu0I7WJOB8j59 LqS\N6ټST¶17I"V>0U/, &/vc͗t`\FyvR(?zfl`<7V8bZ%A[v`el@V2nclU@wwz\x),3= !K*Smu]mXk9Ŭ*''K𵕒phQ.A4zjQyiSq-ΰs1(RQ9# EJ\[Y"7XG'T{=/2ur?0eM#!gsb,*>z*.R 7?kG *$\x?ܲF@{$,ՋV"x cSXfIKG̚2+#ow֨a Nd{neDfA)&''^פy%n3RP4W96RX@AyEQlP"Op!b u^!9;yL7 ^S1tDVy $?A@;]zb6?7퀹\:ߎ=JKo'iYj~ DH) FTd/>5IPt++[^|p //B6V*JK#ʌM)|( .,KF&ؐJ!.pJtBWy\Q@dn}T?TTgN]N| D7 ݧciz& Kg믃{}ƭmR:˺ >3k\5D4~UH$Hn'~w9S1+*) mw.hc|; jt){"*"ArF\-s" Jw[ث0<* Gq ub>1 ql2=>VM3 _@r/ zS8q©ZD=O))zl^A*"Øv _]O,QSA'鹋||w7 M?o94S(/榈*h9B"H7b|xUC&k#Ǝ@5u-3_`^8a/H/akrF |Ŕh¨C~-\vA^ k' K?2u.<$Yܗ3=M=o4he`{4]u-wfhkc8ȢGj sQ+ aJ$9>IA!83ɥ%mQjAZ.8DLS} ^ӓ3;+-[<ϛ@!Yȓ Ն|k`AD|AK)p 5rb+ɺ($i@br.,IbHQ%wh6h\I܀xaqKWzd0YIaF@MEpZW-OK%`C`?>[%' 3}tiP﯎s 0dBMc n|lNI@ '#r`AՌk k&cQer kS mN ZR)3px4dB3i.ZXlcc (uDJB_pL{?X%Ԁ FmւvFT4Kjq$BfťUA]֎:SݱsԔ'ÃTզ bTƚ1Q]K { /V QOSH+]%\uG\>eUhJ`n,MD -&2X/# įheO[+K . '#ûT*^ ͫ=/~l{ blK& M7<_ @;q&J'c`<1 YYc+jp1VF= {D:f. ~Lq8?Liؒ>30.̚V`Fܒ'(zn#!l6jW Wye/q xvkǥH_Ş֡r7QÇ!jUٛ4'_:|ΥK֮E+2g]i-T+x wD;?\ҭFaFƢ*Ya<lqzlB2YFB7IfuP Jȧm$RIpD-t?՗덫s%I^l@s9h\ gG\3(0 1"G ,}:#yn@7e8zZQm}];|T1Xi,Dm 56l/mq<4vzX 5/ P%W=>퉩 6}6i)b2o2fE'j JjX#ʫG+՟t` ޭac $/"C|>FVD "kYrc`3bܚ&8-K@pA)YgaW^:҈f VoZdPjB3Qձ}wcmq)v ɱydU{Z-@+yî!\_5:C6 Kʼn,sydgQ܊D`aj3=DO$Hie|I#꾷zLрmF0[vN[iQU4ewlۿG.8Y?&~4䮝<*CPTO훺e\·q@@:b Cd-^BTz~^Ql9lLRŘЃFq&*"7.M4F}y#y&@ h~ZOc"H8'Ԑ̋N? 2((Oe EQkL ɺ=5Q)ގEUU5N\r{tPw^dn6" 1'*MYDȐݥ^  +s2p1o | \lot è3O,RT"cΆq&b ay@z1Aj0*ĄM@E>6haOl]AahX?ǟS|JbS&3گv}Jnvc2rLv\Aش XAq/6c My"azҙK%+5v@Gy#%"xTlE q'1DzӨ`kR XEhX~"(g @;0xp!ֈTvRW7!m{\z g~Q1ɨf8&;zQz]Rvt4o>`}oM.5A̢ׅ1! `ÀS]+I9ǘSw3 ?jsYC:j>\,1kB+Nj_sZG'{̴Z+:;Gp[# !{񬼯mw^ EV?p,9Ki3t_b \^PYpܱUSYbVn֫!qpqlR8}%[\D:qo @r2M,ɵ7Bvl}6*8N*-w$}Ƕ9ן]`f_yXdIܘnsrK=q%O)^,i>NS A|TC +Sc>%߀5N 4jd,U}>l)܂KnED?,^=є Fݪ''8̗$7;x|@y`[Qثa#bрtC'Hˁ0F7ȏt,;ehX ~X5>D<4N +gӻ]x(C%Rom|mϐDZw _CǪBuVGyݜMn`K+Afk ~A%eN&IX73|F,\ =݁Mp1(B3Wh bn\`ϫ8\е<tT71u )?:G߲fwy#׽2nYq!pK{tD!6r &}L>x"q~ L xH`Yݸ{-HUЇ E/M##a"e^MK>ZrYj] W|G-|u#?v-f^ ]H|sUly s|g 7I4։ю±@Idl0RUX.JCxx']&z4"ML:><|϶`ۏ]y7PJB~]=uaC)!׉Ze>7Tʆ؊3^g,?gTGHwy8h޵P_;NRơknt'QQu?m10z>,L ia=PI6"! 4GvVX tihgʛzn@e!1HbF5%$Q[j~I]tšaBL^ lVVńǚ{&gc'[tţ_1y8H\֥SĞiY 30t[sBPvGy"8i>S'4=`"G@(tCD~[\hE ʧ'}9W'#] \w7PCrP$Gnu@q 2]@a,xE3; U2V3zN,E#*7^=wAiy[J[/^ \M(zW>|VyX޼%0S1"rix X&wQzp Rpu7e?LH*2ފ@򛬣һ́yq!*cD66#9  '6o%.N3jɍݓfEXvOj&4D!S؏Ӈ`\:UO0u1fQɽޞ] ?N"Q%c FWiK#"_;ٝ*Ӈ Ojxn>F Q9ҵKoqM6/P4r \ieU{:Ib1.L4.lJQ"t.l,!µ:fg6_M*X̜Q%Q }?2^frrhMw Ӹ h_|Ԭ9->%(}BDG7@хo(:=9k#\ʹl: PLӜNl%Mz[ Gwo]/lzoQ5◬b' Dwţـu1{dQ1ZRG ޝD\>yYEmwTR`7 %+25@H]`QtJM2/wπ襑BE .&b]L93FZ9tpFjc cSOqk}?g.N~L2@8dC^!v5e;֐W5r#3.#9]TbH-uA8!8{MYfg]U:q}>mR_vʖs7PSD;B+}V<R f[ɾpټfU0fܑ$'tg.f8oD 3Z[XYݍwtk]/"NbffTQ_&2s̟l_ 5KVSOAL#VؼߴOh,C!7P ؾzVڒAW{f޳g2ت 꽹Jͫ5j.cȶg$ g'F]->">?!]"(ԦGk-'3*2XIJft4e)R ح&.t5T&;a٧~Fp'Ru7+Y"fB֕Hj &pkT~.}pvtJIR4ُ,vzARRW"EeA}z 0NHFܺn12.l^;eKPGvbO >A\; [Q=Bn<|T"@hxt_3SFf !t(cؘ n WQ|٪ysBf-rAm(I/3mT^bli}:ԙ[Fwɻ; ?/ooM0˦EE6g H,k{Sk'`ijShPJWXv0~l±g,mgBG'/Z4nDnB3>3ud?`T+`L퓂) ~*H*0zj́Rycvkee5])OcH;"ǹD+ŗBmݩTEjgҧs3[Jd"ny xv'!I37򃈋С?"S8/Yx˅ҍĪYCKglxEӟ+ Ԓf@*/(Bu=O`8 H @wq*֙9;\ e;4XM%zʻHx/TA=įn7[P{Mdh*cVgQ+{zSWb]]C- m6ϾقzÙIif"AlR:lɶ4 Xw;UbAft,Hݡ0K8䐸$e͛d_B~ ȪtTGFl@F(k[S ‡wH pӊ­L18'o }^[6tnj) x<',** =D Lsk9 ײr#6kֹuƼ\Hȷ,I<PEk7Q=zFɊrx(VW> 'MɠPddWGo!CdD~XCҤ,fEyP,,>ߖ9#khѦ%6LU0[(Hs%3Sg}]TＵ?ud^HRBGZKk)spXs`IeLMH#E.Vu8U~7ݾCKOuڊ矔F3:%sln'2\W`BeeM?h?w%RWիy,p-6Y#U(){K:'*2ԤLQ%Dbc= s+Y=V 71 =S4ՁFrC(!/(!&}u!$Z;YҘ,fɣ$ή{A/=P~ڍhpj4Շ}x{CJe hHb^Gi#y.P/Z}fJQvNm`DT La&qȌ nT%/Nmk҈¢]-}8huרZ>W , V"{[孜f$"XŬMaIm *\L VSЬ3CJ?!nޙe-wwɖOjjJ˯9rʲ؝H9~.R>;,s'.Idz3gaBJnrYr9Hx]&v~xr'gpKO`(2׵N/J@N`ǽ1oMYN8ƣ3Ǒp0+v="!P&}CE4Y`XK<2w%9'/xޅ^4fKN͋gcW@dz/(@y.& OK\ސ{f`e",84XaHvm~:wE™ 2q{]@gvNrnQuR?qYq1P7zz6n-Fa}H+ -ND0S5D,E`qdݲ9p;Y\QͫO5ߞЅ);B_n ʈdc@p! xRtSc`h8YI^-'_D˽SLpd!u8@'c" |jRNR)-ބ[?SَKtIڙؚ%71kEn |ǫJaRgWSN*RO?S>6 ͼ2}rݸF!$q:dB%3 jt*-o1rpTmhO[HT=>Ay}VbmK9JE?X,|-:OpLo&_/Į;kG<l+Q?ވ0ʑ&w=&3I |.CY6Q;u␜rvm 1^~TWLUHDCʼnʨ Я~viW>@7ϻL?t|J\P_#!^6-WQ$s(8{dmS7$_P- lF'0̌vO.GFuAqsTʏ(2C$04OL*|VU3&1;*J`gCa@^^Y/Ө`$] $H" 6Hlhu*^p>W`!q$q\ZJ , 歩BE*̖xL0 T Enl:'a)> wG Ss;0V+! A|}>tS' >0NX ۝t(MlPGܾcs<=28rEj9+UM\HDGLo\]W€h[h"Q_? e@NOc)UT_>8u PzEhES [Y)+<^t( D uEr0 ړMna3ޒ1w]:QkQ% sQLM]pOSpҨX?^>OKز9y*Wr*EwgEɂ=[tg;-z”LP=cU02oLʞ{ ާw9vp5֞RgfkVe}yN;AߔꃞsJUYs эDMiv4l!hEE8kt1<`FLV< E@1j;p9*PƄ13[gj![tL& W1;qr֋i;5?$>Jtu'(O ru}\xO{)Hɪ_,a.s}nm1ao/W 8](AMS1 Jz k!:٩lm {! Я+c t:TUab0XҩՊLzYK&cAtζB5H I81RTJdC7K4ӞbhJk<)|m|5BC*-K-t$YU5r]Q821OP~{X[;FM,Ƞ$;YLT/g2<0^2PBy:HYεgGP_n\9r┪km !s~ǥ]7T 0x]D"}ʥ \Ǹ~?r[FN}_#T'!W+>'AVi_j-eڬ+tQQU])&6ݪRӄq#5K*[aV> 8ܘl9{*j ˉgnG/ktʪ)j(XܪCe#˦sQZupYs?m8lvt.\7,-|̪ܳnȚ$c oVs7q  ~@L$>Q c ?{q#II5+xW# 0[߭YEh!Hxŋ6FOx(_c0 {(R^G5WԺ^OU'{x)64aL@4:]zfJMXFop1]ɌYlQvXpq/)7pT: J6">R}5*-|}X#r14\Cn }ܯ|?Zj_kN)OHX!dNFF*> AT_h-7YL凜妔 R;UQZCF/P+Q96~ }Z6;j1t>;Rua "b 9z3}6o/Uc/Ebwq~[UTNu ]$e)oyY3w32.曋`qtOS.BٰJ'|!9Ynqw&U O&YFNEv9mG/{ ($R_/M5PBvS؁BPnh_P)JMgLT QB.$Rlr8rϱnX(}:P}iSFسN5z\mZWxT-9q#uSA:f'O&ś'k_e:aڡgFl[|EbI/-^L#5=瑔ڐ-@&G/)d mJ|'u&A'`s zx^9śws+R]dW>`={^P[O]lB<@;΍fYs{ó-?OS_ȟ !n; [I@^?x=>{QN=l<𑲕ao8uskB C9]O޲UF8ީ'kw p;2XNd&-dϙXYsڊh58U]J͆40D!zze.7iyuudV bE+-c-q_dVۣDz0I!}$>zEh=5Ma+\L2QP($lP%M::KqպnC_HJkJnM-%& L$I&&xh鍝;;2Qvjo*$džY8%7r=X: [A#5ٶ\* o䁉0i .42sOEuxJ:F,F\75E݂'LPqTȬ>&2x][]P>&uhІRS尢8onґ[|i1{ҦO52j ;ePj?S(KM+P)-*dsVs!\5] %dz:o yɤs.phZBB cHk^q1J; .g8(=C(j/䪛MKO/5t֜q *y5Nnvڸc(ASucTixyNYhڽ&ߓ"Jm o!@vp4 kiDe,w o9p.0A`6}wPJ?\CRͧKY4'>ܟEe!K GF$sz@}I.чB.Eu&-˟Wy kӪe>T&-KMSS(!nЇ s'%Mi8f yRM=rM)`R ZfHogP båwR.))`Gшx9xGDŽ6B-%ҔgyR _}%//!+{6ORq,IQ} @{#4%:%qßYgcμh]ÿo"ڸ&g>Ws(y9OYphgHcvH _[m4d v8ԅtG ;@FD?}:ߝ -F0^·,> E>nSX4Wa:L/ڎD!w촞}%1W}_/fW ,p': ΜM4/9d0+6ST\Q~bjj LJactr3q9d_ؑJa AGk.B3@TUk0Ƴ$?wt|k5Btw@Y,#^`t5J1C9RU{mۧ`riq41ڂi< Zf~2zEn`+\&evhcU[)"e~7o0O<v!7Ba_dg7䎞,6ۊ d<$G0Pe_dkTtb EGĆݼ0*_qY+[".?B[qjiKDK1s ˥3>yU:xb!'?h,6&VZeR *qOLv#K>"8mNzy>ãk2r9,U&arD#,GG܈-2e1Ag-bp]V΍Fݦ^l^وIwg!ʧ7x"J3KHZqy]"+B.Gw5=5lw . _W,zna9'6ZZ~dг$ͬZތ%ArMvHyи,Q*AtXۘ}b<+~D}h*3:b6DC!1fج#9޼Z>c͕(OLI}OODރ kړzN|Gv˦]ڌ襽|hYֿz:Uo$@_*P%1{0ytoQT+Tn&EI ئw|@Y2E쫛7;}+|T$҃'XOvPύb Y$;O)ki@kiQk~# ~]|t#j~; N;&#+Ěq"+K"~Fd5Kl6-uWgylWA FxbhyHCH;y!6wchW=x>G2Z4X@RPx s=>>hoݻkX>6a"ܗ Fj FfiPQ,A•e˸+phw+=f3gMլ#{A o'˹I%M}-yy%b8VLg̕/H[m{?*{@2OÅ˵,ʟdEb*Ȏ,'gͶA@}u݁5QQri2KLIQ?*~F-b;ZT E~1 *tm `38>5Pdl2GNgL NmoTsz_'?g$'{1IlV_MLm+5ENpXͦGb,\9d4{!XN3" tC)\H}s(IruLx ʇ 1EVmVؼ zW+ ,Cs(ѹ;JŨ>=O[7*Z 9aⓗF[y>Н0h'8/9cފ(X<кm;:8*}?ez>&8Im?qkF,P֠bĄ T;kP~Kg-iVPk][ 7\o4b/:/maRWpQQ!V$/b"I?7'fΎt_+ʀy֦pIv6'IH{{Xumjʹv>S_V#av-I.rgYX!hn#')Ahe8:2:m;pI=p džx8NuviQpr\IPv \sRZ6PwowFhjy OS8E|JpFyWL? QF'P,B_N֋)M]g%TTXY: oZd;YṕUJWPM IӫIiQ78MG!θvyL0\,J&PtXh@yxyF(u[:r&K&2$#%1+q>~Z|mp >*Kl,h:Viբt_~8Uv*)\֔_jQF*՘ {=_ ./#p)Q*R'il.u ƻ;'~Jjq#QP[q$hܵ Ah[ܰɀZAHN|s =Pnb-9VCs(IwROEf GLU@@yz&]YNLaA 6خ|{U& p#3z3r LNI1xcRJM]˯'`rQ9 [LtC- >f3\ 0R?bxM]i Q~qIjc* XSwy`DY$Ou"y ;I?l9-wgU!jcPT kv a !Vv8g .b|T=x0)49)RnЛ)ߪ`0E(3s#FUG!uIxbk-j=Ho ;i*tڌ|컂 ?IZ\eUmp}4I\GW|mz5~ ɪ,CMoaGZK]VPG ɀ˟]X?nOi8{&oFĒD~(RGLgyo_iY[(B=䙷b4>wr,ʥxxv7 9⍜44[ ]혎$ZNyYnMBZUQ "ӟt+DCJ1p<2RXNB^YdFsDZ/ _ᾫQ0y z+.1P,V )͝1Gvowdj#:֬VvjwI)A$;pUɐQn ^ 0K:[֊o΁, kM,._Qj-0Aqs)*%]P/Rb:V[N)D1J PTѷPLݷU>_*=)عp+$^IO7nߙyRSֲӋO)צ=aV눑mKeSzS%/q $N^e.ocѰҜܞnbX8Ov~rp+]8u3-%\@UZ)fdGQEP=?|ÍށFrIM{6DŗqT8-#FccfȖ zgl3b]/ߐ20aۙnF$Ӕ Q `Ʃ mum }7}Zk6?i n0KGұ[`=hLMW#rTuVUzJbExO߃ MjW)NjJQvB]qOiՏO_ ͵9&+gf=q6~FGYlw<)8F)1~lfSW 5(m8 Ii^#X) CG3hY\~ۥ*ح ME .rg7 ۙ;<SQ$N>BH5ߢ8ǸLi0S !MāsrZϨղghObr 0Fe'(>+8LEP}X>}k :v)b(kp%D|Mg,_ ejkE`rUp{iӈ`U90(*"deWϔ:D1a%'d| ́)0ޏI(r5E8\;091Mqu||"::¨g[b mɣzhn1 |]QL X7\7H<B?uS_@\>=phNvHBcRhEr5mуv xRRuBv -86 zB0`!fN\g޺:4A̿;0q]&N<* ц1(ѾAWل܍a;DcwT  5VU%k? Rw> y?߄Bd #U[w y `ב>4h7dMmíL(i܀riNse!ZUc-k  3p>fqbkid 2(~02&-)Oʿ΄%׬mq9sZkf %I̊YyRՊSt]I>܃-qxlےTLӍbzPl2g z-NRFȞ6ÊX+ "|(^`vrs^_H} OPw$YW |a?F0 xpqH% /Kҙn✗u`JuK^XREZ+%=!&' gGfg |.Eq3.QZP_uCUC=nBdo}HU579-Àz]ԒaamLI@RU{g 4(<dH,7AII\2UIqUKXBHЖwE$j+AJG\@f݈Ql[wFw0@Y,fj+ B5tv1P*1 xgr̖o3RСhz.A& n EH {*:AV_-e s ˺ii(G7((7Bg1`")谫k >'QK޿{R9DU,%oa!9k'{s.1EsuN𩖞A9ŪAfz|. Lc>}:V{g㺁:C gW:GjQ/$޼BWR_#*m=E -~RJN=$S: n%&,?-/BUsT}H_B>^նWBtlO.<ӈTf}fUdesKMlB-I_jMu]]]e;£^ۣhϤqI}C5 MJF7Qk|y$SK ik,zfҰk& H’8 , ]a>DOik"t/30i`pߞ`4Gq=!zD;h̷m,YO/7 %hOHweBH#OQ2LNQ;kungwz/jL{gG8nG3bF*p=P\)L* ?bd$.g ƛo=ݘJg*' NAt ?UXm 5L!LJ^rt Hr؅]>W;LxIM-xyESoI\ǕoO.PUUM8'iJY~(Wyv 59G*)d67z9aA>lgIo tE9J f3fj˳W2WO'滬m9ai?0o]Gbt·5^V1Xz:\ )ְݘInQ_KO -(t<(֬Qb'$_z~`3hHc/oW&J0\`Vm_(J7,~LB鯊]k\JM-z"SOJ  ūmr}l\{!@%eg5O+gPj3߂腺vT񨞾^Rƚ.HY@õдV{mnܷ't$iި̠2"b- ?pV%c72$1l3|\ ?AP]=5C]hq@M&klSQJ8#^QWOG|CJCw.Jy$|a ?cڛ\:FXA.A<&LKgЃ iFKMP>`\W :X^zb5͑ݴz JY$ R]MB}9D|8_MK\aKYZKYҪz=$\K}؏Yv~pM='*o(%H;ׁ4)E %6vUte`c 5Ҟn# Xrj'ReYM_Z'`}*ԠKPBU")NF%VMàIEד`-;Ij\aѹR;3:Ldk?rA/[Dd\WB" ʴ?>i1[nW$iH[Ekz]<vy[d„*sETeII{5+BTQ$dh59Q}V~)0M]g׉ iyfM̯?Cd h4bs ^j1y{'2d$\.JNfu@\kMTAe7 lbefz'xWtF6MDMtk{/l+'[4mo_ͱ(1|;LJ-007`2G3R#VaIʽUV#*D2M&FMϝ^w]"Gs?@Gp()1 إBȪ}1<"UtJBʂ&ml@HC[^KZhoH axy6 >e ;Sƴ^ ڒs-A#y'($)[h cp&7ξ𑅳w+K bƓt7mw'f!N`@G-wN6Ω| ӣէPg^"pߺl6h4j)EDBTq9@Km?_ۘ(ڛɛ"쉤O1oaph@{IONpɽ(|P%[-!;6؂w w4ԉ݌)wĵwaaפJIg-M/%AQENq8 rUS)DX EE >wn2 Fjܢ֢{puNЕ)@CC zB5NPE[#ncL .\K ,<Vרp%—d~cvl6ZNF,/ڨ1!ezALZ= DElTSҼ񹦬LoQDa0h{ !~_ YZu7ŝwG8]+&6ՆqH2mJ&VzsĬڐ:'OW~^y]|NSkcd2uN3vy<,k7ndu +]eiO|H2UYd]Rzlא" *!av4l KQolsʺ8 vO 9L#D&LJ :O,yۀǿʟoK%3s8ڵE-8t:w3eR:Y5BzsE S&ǥ/n12W' eeʲ*jom_M:b;|cQ.pmQK/a^u @$P6:gvm~!Kx4Ȱ`+̲#]-bb;Đ Gzą9#LGTA-2 f= .:EW-7j6?:35P]2XpiRWXyz?fq!euuONN# qBcmqPA"NM %>e eӋ %aQٺ#kA)ʬc?;w;aŧ!ja!}4.Lοwuq k":Z% NfY%Oe(?Q'&=^dd4N "%/<)8 ;q!ZsVXIj״yn!1u?n]dI̝lQoB Mb*LiO#3=FҳW|j|c#[''^Liաb+#8[&(cE Ź"Q _׌xۙ^D|8 Ƽ[Aw<ٵ7񎱌/q#2(vqsM&hdBoS|8pJGfyn-&Yrhu[;T^tTse:·j(8S=NMoiƼۆ́ ;&wѳpIu0w̨˛fx5yy 7>7זf8]e >]* {; \,X?S3'nޘ0W(4AX,D,b͸hij'mS\&C\ rY_3$b]v0Zw$(#]o:I(7)\]CčL#"Ygm/Gj!vM-rBS0uеՁGĉ8q{.vޤק|tA+Tek]Yh-RϷi vhxz[/> !=i[?$^u>suTS}h&;0ă$٣pu&'K!bpբ7*1pftk;y%n&wihP;E+WbtM6N+ݐ9% Dr ؤlU63sAi0wh]Y9Yvs`04qJq344x,s"T?W]FG2Z)vRp{/O̐YrVK}шdi@mUy~΀j^VYj[?h1Lu3t[X{9A|v! ^gB5Ӡs{y az?0jsW2*s'} `2B`5-y)'ƙ{- TDjIm^_!d$+=K\jK֏!+Yф]v( *h_T?, Dr'ZQ&xq|EV hhٲE/U@ R#_%X<ZKضsK9*.~)Ia*tf.F͎yX9vIZ EZ4ѝ3)Opyug$Fsd)km zpJ3n>v Wcs\£RZ@Kb?=T9#Q2{%jP[y%a0!xt)3Xi|R9fȇ`X0n dGlhoa̯R-"ȳQ@FT  a}qPNye˨MpWnO S7DYfj䱗l+NIJ[j#,s'^*3R#Sʬ,gwuDV kV$x `;ђd#T2} 6'ܴDb8/L~P.Tq҆A9b9(P\Tp6;w :f51\ybll$V*5&?&^YZ bwUM^دoqozHp_oAɧDƒ,#O4r=wSAu p6ȼ$\PUG&zRl`<[̜6=qJA*\ejkDW4$KpxU?%<Ǐmp0;.cg]'0"8gYÎ k6oNޠJ0ߚ\1<6Bb4VYۚwb ݂8m@'k5|35ܘ"ֹA>lmH]&/7Nw&!ʛg9ne@qZPdܭV>I8wPM7[kʺy(Ξq^}0m. .eO nw*biRk?h; kAb#{C~Tp l$3!= \{&#r^X f|v+sKނD2]^&K)2}Gœv@{M)&]0[h1Mn(52rϥžQYt0fJ^_Gz_u'BmUG_-N[TV'Qc2u΢. s| rk}b(6w3 y*aE!-~ʐkڷ8 %˘;VQӑ~+SHo<+| oɷ`Cљa"qUp<%T l6r"!'ڡ/ɸPh%Q{*ӛ8-__ZQ9}T&5F:a~M' h/Drר K3V@a1sΡq{ҏqcHs0FC3rpRrҊfUtYLKh $H?~.=;hKꦂPs4+5<\]5pKI;}YvP+m?KNag]<;+ĵW/Bwr864YAYSb$DG~ mȝI #A"/8\?9봏 |κH32] HN "P'|g;.YDj}Qku 3>cR :-Il,[>Z(=$4&RX&gҌhE:gŠ "4ڞm&uwL-<.2Tp cj`a2QH~LW ,t稌_ XyIC%ᄨ攲5 Z zsoFtn&S(־x6td> ӛ?ZBl?? ;E;2/B]> r5`&Ry‡,@ Gn3m-0W-EqX\ZolvjƤJMo}j,v>`;#:gEgU]1pjQB?Nnr 􆬳K-gs}ܸ ^L:5Pϳ/cmSKu}HX#w&zpl+oyDq1Z'iYfPA#6#թ 2'?]Aj רxS B\,^WSgx%^Z`ГƪOSU=[]y11 F!SogV4DlkI?f&IDີc3楽 nLcLiT)XVAu[S";LI-xg] #Pi-9ûtLsQ[dl76IsB{J~n{tV(*rz.T|e.4PtpB}WfW9/F/1N`bd.~NFi;/-#ZŇg9w~՝wR67R*{lV6|܁-]*?EV%j3񧊂z)Oč5[ "sI>TفV]=ǭI|e.L'Oo'W:H)38sѶTȵib~ 3Aʦ7fLK%f i;:~ *_h.6!BI'Ơz˃1|Ut5N x~ً_\#4#ڪ}} Ҍ!Sa:xcGJ7e`CŌ]L~ɀۧ IBsJ<7AϟslnDIh9?ܒgV84y6aY%GJ4i]tyv\Ĝ7ujPfP'zX"|{[qWtrulLw ]*%s^p9J̛4vf[aª[$O" ފBAt^W14dǪ%zMB/%&}_i{񦇳. &vCy&.kp6iK`x [;;VMwG1ibkc\bڊSZddZ(N4{?.]ed'{uY=ԆFMcp@S.>:̈)8 (Jƀ$Zj?E`Hc6>MKG :H0+(ϛr#ƏrSf+"4M@GB?})5PZiA({iMeOa+)k=.-C;S1lEH:̵OܳYm F jRyJ95,̯W∻C( /M W!=lHNKEq)9"s}Yq4WՇivkNPtF[OMuf兽͝EəYۿWY\v/yZ'c:<@CR>.Aex#}FM (c[Zz{YBrZaOD˷2 1S4rS`Ƚ΍dno8l=f hG\fb)sKCdZQm+K7=0RB 6V^/y Sb+r/6[MENu״̍oKdY\sWݻtVs/MO4*T뎨vX]XLP3Ta!d ZF0w;%\҈j9( nF{֘=B_u$z/9q?8,]?FU\Q`z¢!KbzO dٍU{5H_ݷ.}6}2֩]o#{7 h*fZ.R'8:i?S PQ.mU;4ף=a0A[v% GnR=vg9v%uL## RKR A̹`,ó^*m%ei =A-Spj!~<Y_0yUEѬCZyBG;u}r;ګ"fI# vUNmN\;$ +όȎtmT6y0ZyƔ5l}7G}ht!qPT|j (֛{2Z'~tTG8YEC=ڂx:Y--v{X@oXd[=o:M 3GהdI8s6r9Ӓ'_hljc^R_I<\r 쁽s˩Tl1> bV-`}B[{8z\qoIT3)sgm^\=`[03ux 0 gf'iHB;w"o;* |L ؉LfU~pa*af`'ۈGe̝*A_ bI'In/L峱1 OZ;5H'QMCƨIz 2Kv\y]C!}0B'ΡwZF.F"%ׄ\=U7dw-T;v/LNY ]eY$=&_ I3-tb%soNϐ<"{!ZcM P[S)`4xe9c+rٟU%ʖ̓FN036,w] MU@E CYDQN_CxQ6Wf?z0w8aE4dy,Mp7(:_ &ƍ xJGB dsp3rIƒӘt8S9 %-jp: _CM4~67Y>iZr~y%^Kx;Pm$+y蒦20 6WAB_.mL`5"Q = W!cOß>:6 +6|QGv5?hU(.w7$.ʺe).?;❮jpN=/W0att I@H.8D#d:ryo44Vp(Ojˑx/c*TΒRˬ!|\V1{hr2w:y't@3ݽ)S&5&Bxy:Jg_\QMXn`3L֤ /{drM%]al% X_Pi/Bd79[K V:kg;uƑup~¼C`m`J9J,I(Dq4 "3$SRlv,Y }*hWf< ~ޘnQkv[}|r?cM LJrUxUԲNbC.>\ɥ,ҹH^0$bˤwㇻjrU)VxFf)BT, |77ܙ1':mXj}-J۬Oڻv*@ >]x=5D g'(5{U/Dz/;Set'O6zDMIA7S+P8[Џs0䫊j2ZqӀ)EqIS}4AIPL fJw)|uCyܬU2p jLplI!2.eJq}i_x:2yje{Qh\=l>+!@S0<2\~vP|}%vq# uݩ+E}2 $fe:pnhf<Iѕ wMn(vԐQ#TL=%H# r#B)v&ʲ8$0)ѦBu#tNGIq8 c6t؟~CIjjƮ}K V5o򞗾Zq64jK R^4o*,;}ϋ+ͼ N #m[6tOw[P ޑ2|s$|΋Iz'H.,IБe4CP}`_) q Uq.\՗!A {qÉ>4395MԜ ucf <ĝGM +x~\ZQ9 :BZ_k_`!0υHuoIB?+ZE֣k5<"E^2QvԌo5z5deI#>} u< ^CC >DZ6A?9xe9w sXaoQ]83GW\hK@;M=w,qȏ7h].?6lR>m&֛nϟ݄& NTբWߣa'M)2G{C-el3]=+ڱ&Ii80DAZs@3S%* nOf>>.(ړndXr)J/mȎVb(8 g~{QPV琑ml:SnhQNjTin,e%)+~d۵ü%]5m/FR vZj?]d ^!Jp}::e4 $P¯ x9 (_-o*^anMkAA+1_n9+*5glq f Ƕ^N[- S(8-L&O#u&˪`gQ}qJb,NъG+y J^0mc06;leᐛTڞAsg WsbTÓ+cR"XWӾ|zW69RhMr$ hBOK_VX'pO;GzL_)A!!9u偏Z%@HAR՟VY,`$lzKy'@ Εĵ~ōjގ7=%*y" uI||t@Ag#I9ӓKc|cTV@fgnR. DS> [2 ԆS"q;<PW:.U~][(Ұ6Z~{&@pUeN-x<,,V\-N^Dylk jal% 7ehאWY0k3MVoVesAW⺟ 'Tr<]ƴMʼn-:8^nmg&9WEvʯcwQqq)9DX9 t&K;|.ǜ5𼎯8 vJHシ HT>5' =NAXd%|^X{؂hHf61<]) w#H/`S<An+o:`{gJ=^Vt>_ew$wҔe´bw ƞ~?Xu Ôb/|d\<'ROeKv1Mgc5`:]qN{rx0i֫K4K*R쥌!(%?qwq&g R5Ö~dM F!|p?>00\(#ğJy&k[Mx#e\0_g0«',;/(Rl`96#6,yVRáA8LSqs;l .eSjhQm4Vca bq<Ջ~ u?Se tHKU^$ v(; NQv@[[Ol}r2UCcZЂt;rr: 'Z@LhȃJ]oq"^JYJ${. O1Ħ|K9 A?ztS6 PD#oZ)VZ z㦂"` Fv(P}YΡ5Kz5~[(#jg (n-6KPԡ{kfR2k:b-M?Iƥ>IO) LE8gIcKK[&4F&qo먅mya<EAejOąs!*8MHOGԦ2L5dYP:t+ oq$;xx/C67~]|rˊg4<^髖&tEUJVS/C/Hv,- 3=k&!mL}U*%@!ymS!ȝc{,iKk^b! _t@YOݥk?!V-Bxw 0n |ZMq?ɕQ>@nrz#P[G=`}%h9@?N>@ J#Q؀v.}-+g/iDeBsE#}NhZj"vISwop*!1mH.P0zSz﷐K`|uBg#1]U,{׈t;]2P8kߟv6DvWHPDխ6_, |]/!xKfC/7Z-KpeAUtk5qY-p2vǙv&?6)q0,guĺݼgkdsE^:^Rԛv+6D,0ԗ% }Y":]mɭAvJMEpFd TTKC JeMORK_m/C% ۦs]Da!RetOeV&&p4-> lj\N4rh[0j`eA+{K"(s|x $;ҍ-Ov54; s@m!V%cam6^M749UF>Ex`n#v*Ahb @6mT!t jNpRpvObdRvMT|"Rq:ފ{B. ۥx>-lK ߔfOQI@'f>ܚҘ"JҜU\H:tkm۶D)BmH@:u1=Dd!EmLsrgvMZ"//+cӸ*[$#(>x;T)x|rÍ`54оTr_y~hLfRi}dCr87ϲNO\'lp?ـ̓G(M;utx_p fV{@RY;#~2\c <^-DŽ " -yv0,iރd DGt7 PzuIemTKSLKwEOxcp>C"Fpgg$d+UN)-h!Cg6L(2o.5}^ö^M2B1sUo L?a/7Wjԋ( s:o]ZHg?xI8TE!b_|6XKΥ7@$.Ɍ˖e&sWS;)kr'|cR deѰ,WQٟGt1O*ުJkJ_ sD@")y̴ehG7[\`q_vˤƒLưI|lERS i۹KW#!lCʺHīp V{E/fXV%ce& zТ ̌da),~$hr^[JErI ;I,Kw,@1-5O;CՂmUH#N:vEӱU(qȻ'X>b::Kwka^~2,$PscsX ̖o)1 .y"odz`_%\QTff"A}&~_Lծڎg| j,lhCU(?(tB^"Ԇ=C婶Uh'QQn 9{n߁M7cqp[y`FˑfO {F[> c|M[ `-/_$bcW$a25U0-' `%\{VXk4,I YCHگ!1Kˠ aђ&O0Kw AGƭwEnL8_xe>8%3h9tN9.7NDRmFUaaP/`h ~@4PBU($c\#q th=vF%vN:Ajږ./ N4UȎK贌ˆĜfs1=M(%6{"ygT9nso;pgimq.^}/ySd{??F@tôPhS9G!aAnSԣy!?#_n(U/0KH Y y1z\ p{&m)@d&Y{K^,φS36wC8@ԿEITKT_0ݡW!n`cr+mDW p`(˥nQj2hַǨ!q4jh\V5&tղ2vʄ8ߴ oVI2P 6͢XI(+1ˈ{\yL!g C *À! \j]]3w R{_I5Db,KPCjLDpmox{K_`/Mm'8_T>ⅾ?2|w[h]ip~A|v|O[{ ^u?^HxԶmvAajSL#0Vc6.`L#^z0 +j'C!6;1ヺTyQ;]3ݢוCheI pr|Tf.&{Kԕ_@pB(3['v@_^ф9"CYU $"OcvxEq.mY+?|YE|B摿|L63np|GrRYosN"0*U0zc6>xNڣx1W>ޓB=O"=3/; v& Age{3@/sF'+iIMӳZUn50YjWGt*A:cRN]; ŁWKGuBG|jţzlApNgg0~W7ՙ:S 'nӝӠ TZ{S=f'b[Gnj?]XYJ ֈaxjJ1'^^Q36 wY}) L{\ F00~ 1WJzIAֹ%GJ h"7.a’̸?i!t&eU Hv.+|ѥuE-Fq5u5{_ O!T/ vHWq>xEX2:c{3yzpdՄfϙM<2Ɋl,C/ŐХgC~#'=%eX3r}koSY&Z'CT8M[&%P/MWLCD{|&Ek#˟~a@I,QtwGe+^=Qn!_?e;N-y!9fCÕ-;@t'9*& LxPf́po'o~Uؔ3 ɋ8dT >H ٫=~$Jd`y 0#zDϙOJd`nY 8Gc7Fl7%'fBZ/򮱿 ģ,aBkp غ֣Pv;$OJr{Otn'b`OV)o^t6=Z (@--sA*㊄!{IW7Du€;9E:{Us%]Vnr!"k/r%&Ȕ CbKh٧^`2>C d%"*|,vS1 @V]c i *\Nw.V|Nx3DwC~o1QkX|Bz`pJUVtN\+ll9KBwoYM7 0OENPFFG*W-:5iGC0ZeNPwϝ&x&,\VYgDZmd`LÞfX\ƓlTg)n@6cN2b!]*=)i qw,^T^2fnERfu$UQ\⌟%1,N.] ݩ݉n$!8khޢGk$.TS@G9H^x@Urifis2÷HP&t_v[\H' d 垵Th! FA<݆9*tmE #az˂b;je8O 7@G3Ѻ>i .,C<%h,sc"YV'VEFr=Ǝmi{pEYN/ W SF"|G;+{Rf_`8C|1cM#&~}N3oq3m$|vtECAKF_@wߦlء@<VQrY{j@yLȐiVs0#ˣ-B0(;ޒi,9x 5E kHceMrR_0S1(V艬 $lomfuQ~ T `/Q-6P;7xR#/1=_{nݠ/^)T@J1Owky''=yXQ.ۚӞ= ;C(L$1.\3xS^Z_m~74mpTIayC]~lS1[}@q ejBgr+p*ړF.xzho=(~bAǰI[yJ]6:N vK=,3z!( su2يEg"D,uY ƊH~"ߪ%tR_؈N錿0Dƿ&g yE*d,tc\nC;ӿ%{P!g ./6$Cx 1y&fg‘i2Ms(a ȽrI<m5 #FS zl#[Gk1^?ͣ2h0'$i {SS}) 8ϼpֳ5JZDŽc緄kpJ!7 7Dm2N)\N*xCV(m,HX %`'Il3{<Hrp:$ٵ2kdA2&sg"!r_7׳i<#^N\̙G_Bx^_.?G[xCL,U[Brq` p JIZ(Clk ZUKYңT@SuT+Ψs /AСh\tҁoK_D-`NXpP1H gGP0=ik f:2zN$ɲNf)L P}JhBVjZ~8bt\ Koj$$ IZue]VMf9|+dWYpitF8QhHs'F}yZN8MM]Vn`_꣑5?:2$^ShK|x=IPbfbLuT`j(6D?S$&;\T -Kf0cRnE^/\rgp`5go],Щ-Krݺ9-=s>S9f7lDx Q 8dԪ&ԫ}abCp7D2|-Sf5|DZ9̱*Üqޕl{wP`Bqsr,F?ޤiޠoãD De|Zu!S֋rK#;yC0%=U;8Ei :)Wz;φo6SDu)o}Y!N^C|U.%ʙKŃв9bGSbM&.IU@<.7CWun?`{ԑBVGyF-t_~@jg]zkg.T-k6pH#qȐ8#.ڑy&fEf.$6vb2"P5ׁ2Xz8:3 M3E\]83# ؅.X8Nb_^8kB4q?*= W\j^Xu=7GY*fޤH=Y; K]q \őq8_ZrOI L-,aˈ9y1L^^|t57j"/B&ۮs345t3`Lr\$XoL6W TTތ%5ΠW*4Bo TH _ 탆K=Z6C?v|֫G=qI_Vyft\|K_^݀Eob{OGOtD4\F[CN/ ([8VsH?! !;NK ;-;0)d >),49`J0iPCc( S w1A0 2C97Z؇$wxؙ+3ׅ`>o>@ -Ě6yXkмP]T.!z#y]٫J9dZ*Z}O MpN`HHf$@js;GEX͑ޤ*ȠgΩb{~S>&o/"o9Xu1{'R]Is=ISX1X~TO,ѹɉ5%C Ͱr6)v]m+h]k慕4_\}1n#صF Nܪ ^> `Vlk$uS-_z\8sJP"LocJmBYbV#BA'޹Au[p|0H(-WLTpd9XGHtAze I'8}!ŀp.n]wxζ\<֙7dr=[KYzc?Z";tNӷ~sv\կQd 7oQO'2%(FDԇ`PΒ, ;[7 @%yEnA ۍ^3=W]tAN-xf0:tpq^B.Z^3~)o|o[~+t)s68t0ZO {t/טeiz7Co -o&hIe&VcɑH&"wVurN3mM])t$gn;zQC%(Jr;u҆_j< ы>FW^9_(q$Vxv6cg-I#IXwSEA*{;DD c캼sȁRL n$FO@eԭɸiXm-2_Rbfk.y` 3{D%1Rܜ}.gpRVs um ΃}``R9̰Jeb:`EV 7Y&hpiZM`U\O.Mj{vkrOضUj3tVcZ^ 1hq|5}U\ l@Q!Ӫ;8ByDYBOM$ {)cA#CuTO1ŗR6ĴԳT""rn)s[b-޵&/V9ZCosKljwIdv{)r%5U|'6g%sC'{Ik* ǭ t `qj)ʱ8 yS rjۋbD]YOSy kY^@7 $oLF8&bxo͖l -I9:qi,% PWf_qѓhtj!%1r &6iz4}2x[i R0fqMi#v?u1sgwRƹ˿*lQƾmܪ X_cWی8Ih\f~ϟ~4YŐ)mNTOԲlr-p,wJ#(jo↿FkԝzpN{԰"OPXΘ.Usǂ[idYI/!he+bxȑDw͟TB19+z$K@Jicj`R֕&{NgR_cQ]#H2L_'Eb*Wu8ɨBvD~\GZ3׌K[WVI)%T *Rd|Mb%WG)ٜbR^ƵfI'UIX"@7^,%e}CZZIUä Cw >vwoRo1+Q-X\Ő|rb#0FbỦ0\*3'-SJ} kNO7q_ޯ5Y)ڨ0t>СG)nOKJbjCdhqG nR VAbcZ+Db*մ*UT>UH+p.Av< u ~-'OpFC1oMGѲGq7ଵdD'ڮu>|߯= $3doz~rPOTZ'> H5 iXy~4_Z9)g%X%\"aw0/)i-8*\SayUlFtn]F ﺆ0~LC8CFlTrps$V#! y5D>WFLr/Q (Wf{Y+卫[ ΰhia$SYhn!-4+QKKaV|i(fQV(_l֏?Su`Hnci9w@Ɗ~qճ6` jĉvI%=WD(((cS X6.q6_pBx\o/X9BqMzo Jlm!iw ՅxRn[=KT6%3'u<dž| :cqubFmOIHO}]$vb`A,L׀}"qm]LgXz=p֗{Tb6h%_a&c~P$v{FdNK1<`-(Ү/!-|ΓV&OPx8VY,6qv|[A~Sͯ|/5ؿf1vUs߬>?]a^@H(6̈ *ȁE#7 zpQ9;72[&.ހʥJ@dEX}p"uJOt\\ Rӻɥ̫8OhC m;pnXhaMTg KE-=ԩ(]%p3Oʆa 6eI3qiJE貚^k;`"y 5`!d[ 杫l$%Iڂ; J39~N'`h?pՁR,7=򧒀Rx&)GGެҼLb R|TY)`@=g*hfp]YN`h,1r2prRF<9EQC WMIg\nDL61 coW=BQ\Z@;gY~yu * a긴Vt\`\R4BD Xz隸kAЈ+]q]+^4 + ?|I+a @`{zg+u|Vw,Ζ&WNWrC55$q5QVݦzjU10xԝg6掛/7߄^3ߎɛPn+]js\4$JI:?+PU^͞M@tt! Jc:ovjȏEd.,-!dNBw&!KKKx<=ou>7ڵsd( qa}Sf>nZOpwN C`saTme9BOe5Q`M명J~  &lȞr$ej R5I.,'˲<#,w _!RTc OulfP&O.'4VUu7gb]1 ء{qvdCȯc7LRJ`^1Ulbq"c=, 8Aּ۸~SR1EH{4Ue >I=$%qƚk@N5`2BN),0%f|iu1bI,Szr ^.U3-6/x䰃FBA! 3ʐ,YZ>7+\[=d@[O:=uUN&$6YIfHV+FcE4[mgwxCdkfGC#dF^|OĻqT,A G Y}8Y[n#B׬ucA wΝFQe)Rޤ'0Hgd ph%Xr杚̴&aNg>fTڗ "dNk A>?7V}ٕGy]} Rk[4*u޵]dJ%J2RVѤ%LEw4C(IJ61|E+[sMb k}Jkzu˴*!\uhz^;J6HF+ۂt\GW نo%M>RFKƹQ֣S`C<߻Izd<`=yvξW4cC2$Q\DavERZ5bKQ\50"C禒1Lm{GU`.]e2V#a#d'5iLڲq7bZM=ܯ8gar\ e9纭ze4h86^uU;l5O(\#wA%Zmd\$̍Qƭ驽 9U+X>iIEܥh+sѐmnR{A:ދ|;xp@+WD0/gYt-%od8%}wYzyǾU<*L]鏯ð\e/y|sYL/kᘄbD{Wr 59oQ`*L7J+'v4 [.t$*}͚ca_;k^]I['|ZH0\an~iK vByo7JmZ ޽b^و<!W㬫`>Pt1OE+;Ĵ?CxA4A(6'`)n= 0Gg> TUuG+4z^ݚ$QƃbOS1:"{9*f: 9qG5G$F CPzhkD"BC@Aˇ5P@>Y,=R+ +F$ q{X*)I_s:V9Aax"x)8iE*%Z;L:k%ٟ1N2oZxC}g{r%V[c %Yu^K f' y̭@kR]Ul:Cl.r!aĀIJ/hyLwKMS‰ڼ]dFy+SK㕍il±]+)3,<~xd>H*۾(v|} ؄oc !`Aw"?BKOVi3-:.hpp]CetLJs@>m^J]"ށzHZdż',r 0kUt Ր ~:{gO܋sT Ŏ_x34:FH D!-}XJ[ǻ˽uSA[c*6Z6 B j\5o'VxHo"7;sΒG\W"8k?,=텦?YwhK>#{0K?"P5#xr[1Sб,4 =jő#"4ƛ[B[DvÛy,'HWNY@`V"~JÊKLfWYU!F<6)2/L t=U%ŒRSѻF4a.`$0 h,G$ُ`8KInWKCխ$P.-{6Iw7Hyk^~&yU+_[#Ǫ֧ ZXN:pWT2X~)PL1@r{̺̀r{1|"zD:{[D6Fa,CIj3%ּܓ' _7 kL 2Zr:c#;S)#LDNMGꞝSGG&P:>ٸʯp[{cA=e0OXigU>%W(z͝PYַ臗0Dj }-գ5vnM\>AZ>a.##$rv|m5%yP}/&0f0j$ B_)Ud yWHP}tI_8a<\/x>ҌY[TB*qj=۠Q&yU~iw-g Imj4o[hܨz"Tk5@ <ȇ8AS",G K1O!fGAZ}Upb&9E@@妸nf||A|pu6LRF\5ִC?*- *75v4M[>\jn34lZw{=Dt];5fG4J*}9v;NrQ A-< AƑM[gyl*{Z5gbźK2a!CmNڮqt!uNu RNaGNPoP^yǶdlLRlM Hҕٞ3/eeIXH_ZJknXeV`T:.|=15j {X/xoʆܔ-gupe&mFKqDE )_qkSAbZ629T !JMB#U?zgx%vƦu#V'rV r9MIT,]"Mxz0М',rf$+Vr&R+[[ .R9DU|QAءJr@h[c2 Ϲ@&b ak v?g8 j)XKй$echFm+21o0"r[J0wUW]^(T$02+9t@bJxZeZP/ 8<<&u{dv?V0}WMÈ $CI`ԴK|N~t~ьd2yUρݣ7ۀ_OKɻ> }QTZ'G0;mI-衭٪@ Y W|9rD\6&bW:?6&`jM+rfԟUS5ky#H|d:8|+x'm(LfV[gBB1vFJUDA.St%zb^KOOBsV65F*6T$"/яOyd@O!rW^C*|#Qx0XE]h<كU|jH"YU n]]n{>O\?'ttͺVBLnyţ)O޹s_~r`׾$!5(ĩj*Jcgf3AP.їCo d̶ |DKFtFR}aq7=N-iXYVzQo4%HXro!gԂ]5-ڙq\#DȚ]-i isDR:Ur{/yֻ!Wsfv.sK^Ʊ@"3t,7W-E>˞IdSG-`Z;ÎnUɱ`h ( }WL, GcUt#J)H'{UG!60ow*[ QSj6*ԏdi}6 T@)\RRO rc%yps Q ߆&8+/G32I |j_w2ˊ }FG‚x(a=XP{'r! EzR.oe*MkD@$[qklp+/j٘$؃):vIf΅}GSaqrX"<eǹIb2>?S'#'x54{!P5kqT+jgjJh5;JB-v :,M"@sw?ٮ8{#L.Mg7G rnC]lCQ$CKX.|]ӑǩZ^r >Ö:ߛlfO--y2*dcNα:{Zb%%1 7h逴r9@ׂT0t~\wPY5=#9v]K~[[ dZGDc#?X5+G"#g=Z^Ju*!,M_U^Ɏ9)vR`FIP$+I¯]%U]0 ql:XR.YsRCT$n761%k ".b~E ȏ*hఈ]{{֊F*!m7dVm{[\~9ʴX!sLli_0k︦r=sm9]U[e FЇyY ]-Ddr~uƧ?8JMd8ۗB>A9qdZv| Y!90g\-g 'OsZO>R1@(TXft+I y&dj^S!ƿ ``&mrĿy48QkٟtUV왙@ Ds+=Z%rLvǩ‰40CmiA~~9AݠOcΈg[s[bz01KҕP]]=}qE86S Ih,[/LxޝY"'+u [QfIG倍l΂:-ȦdXכ2P81e83={XXζ=pWvlh9 m/?FzI{C[A0)@_:H\.kJ~-<^zo9HZJjRX,Qw|.  6%.Ga`MP&3ٵ'5[T#'o(b@Z+_NEx۬qW -&, c i MQ6,ե[XH_ N.wa'pP@2"h2 'm7wmp7xZ~ɗ#v$ilc" 9W_\ZUOq`4`ӣ( .:uMA6AR0u搶4>A(btoczǬMUԈ h#ՍNP}@Ԝ}^D(T\J/D7(QٔL~6j-s_aqK B(ٚZZą)ʄwoOMe":]0707Lz_~3E&A9~/r$ lt: ^ޡgz̹U_ }/.@s 6DP=GfK8㺣YR{B.V~Tnfk`Um* CHK$\$r;?evm K%kKŔT dz5Skr>v ef;j5mȧi Uy,8Zb\Rwo;Y؍Jߜ1^5+ޝ\"5_Fb \k=3RMA/67L2-ɩea*ߵE B;lgq@>TJ.-s a?&3"h/ t2Y=x4]@h5;ӁÚ; m3 ߀*O7 *޻*0 ZyH=0X+a.0f#*N?m$*d}›r~ X UktƷT2ȝŒ6 υ< ך\?Nf[!}s אz$E|e {@Vz2lz+q}+m>tN*!7-\'L] })z2]q_r6G.,mWTOt~җշ5#t #{^=Ad}?,4Y …U2U4Gld%11h֢,Mo]=rbP@shHkpԕ3N%1G1!D-kephk4G_0,hŬ(8qfəNI$-e)7aHBڟM17~9H~+LȕB_Hqa.+vN5_*0 =S^ y_A (}=QVtϋZ e*djwN4cCߢ5C]^8R왊>_XjR<ԜV_Wd`_^ZnO[(ؿ m1#j.m+s6{V,ĽU'nh8j5]t4lg}Y@N-q p[F՜f9䇜eBU"mҪrmx=keC.8[5@к[s: {sC9VC]ΞC4 3wty궧"&5,s׾ejZGHBlyOcwY) zTHًyS/ c$7‚^#iȬh#0HW.D`%Xe6ߠx49j }^V-oϘYCO>͎Cq2?FMG )QVÁr7BhhԒhFUҟWx4Ǩ#smf]zVH~ hn@gc%沾f n:{G754aLe3H&{z Gp-ȣw[rRu W k^lƲ3#offU\1xpgeucjUǗvbY2KH.탺DyrF-ja>`W~om3YV}|2{I=oٮUt{5t0be&]+~|M^_ZF7=⨶n%^u4h` ) RG3,; *wNszƽ|4ޅ5m"/4C+)UQ4o?yV)Pz^'eippxJs9CYOMBkзIu|u?ޙkQ J. DdC`pd"DʽDBWЊ[6w +q={qjO/ ZT+I7 k!&niSH^(A!FaU'ucSGxEaû{c67|׋|6g}ږgx]Bf !Ԓ#`)ÜmKٜ0!.B:27BҬ̖\[@@M3bi11v"l1CەanE}^M Bf$&W7m2  S'-bJ'Tl$Xj Мh+uDQTq;aeZ<۟K ]lZ NMm<LL&_Ilc% 2n;%*f/87fŢD%%`6JSZ{r(Mr;@-_}*%n)WeȒ>Q~I d|HB#Y; !p8}`kŰ Eq2n]+2w7_GSO%8_Ž%}$_QW<{2BCJW=>tlr d(xTR?a6Fs؏B~{A.\w9nQs'1 ReY@ð*$ԁl䠳!A> Д]ԿGz<߰M^Nmz=)N7ۮ^0G^I&DSQ$ x0k"_g LɪAUӀ 1Z. 5QooO0vbw:,b6as0ZyC 5E>><@QOj.+jU50 *rڿ<ۨH'ɠ\g @'PXrdMշ-PJV?g?l7jFNx[بW=& @KkL΋NA/neRNq셀$OmM4U`a[Yŏn_ 724KP*6}oFaE3$͒?~@%V5p>L^ϭIjǭ$Ԝ]? `ad]ef"*:T{eGAJjo7F B(Ȍ'My@ZzzՀC:4(nEP,pG7Z&7Fڑ<:&eA8'"#\~FIH4ay !4O]ָ7Jw*A({[ V W4S6z`keePiRB\~`ݷ ,$l'@n}s>_ r$L_[GBC3C#O i&,緷pJ sab /CΥKĩaNP4UɺyQhNF2[,ΛE9ur J};8KD}#Z2pjX> &_ޅ ri҂rm-g)t5x3`'I<` پJ܄J`K^;[OS::5҈2ly "t,}&d'Wy*=tXʄ)_z(j˳I^\qTŨV]RX6MmhOpJ2f iLԮ BH#M۴2|hr6h@?X ^rbO7U%ɋLp y2/)̪{9+1E!ӼcM}c5$Mm<gׂ_ӿD;!s2UN,)Px :Όud4g]G z58m̷gMwC B<]Ff1Pl}Zԋ'Z /6{O}Y_y- @fj~ [I_.5:s$`DM|V $l3[։&Gԉs"U>k]т7+{/QV"J(Jc3D;> V(Y<Ռxu@u'CM-Pv)L{Zs;5_ "'1r&&2$H$Η}ZIXmlm(԰!FjWluQ;I+@_ȖC3- #5tJr *2&w^򷚘KP`hYϙioWP7&'yր]qBsdI]25 )xvX2MsHôGE yjjHQ;cu %'z"-lVʤ{ ^ &һ^”S1en)[s0;bxDה1B=!璗 hTV Х'[7*/( {4Ȍ].{ WiDx_+FP?d ^ (F⬕0ػ =O]1e,Iʡk`P֮PA%s%oU9]Eur` )@\{O||"δMJFxeC?ڭ67ʷʲ}qKĎ;BP!9K9gےz)Ș_`̣jAt{IY`+㡡4 aH$d$"1c}>ɆQP׶Z@|g{jHOWCx4IsR:B1S<Ā½.w5;oY&8'3! s1aEsrf]ي^iOfYc\fq# c"ɎcɡΊv:.‡ks0 VXٴ`6 JioK!S<[7mq<%ң0r5g$P2w^J)0Vk!S/ Yr9dyCMmZ$t t/o%c='DZpDA&VBbQ"]n!$(-#=3+f[}xfʳGl3Qv|q1>Sp J[\Hơ4aDɺ͌ZE&,FC ?u s9+->c2M3.7LMhMU k7iIiUp$Jt&a .`"6=}i۴i+Fop|p}Qx0XϚuG=ߐ͌Og !8\/|C?ny#™8"=e?䯌^>JlHxP}Wg'W!;P3&Ш6˩)d0 gq_Xlՙmro pf43WրG>E\ XV~O+͘G0zXTNM4T Z#1ҩkrP3Nmň8ۃE;ooJ)AͨHqn@[)~]j)>ƣjDISH̲fx+GHߌ}u_4dDHY۟, R?L&r<6YԂ=OMi#Y2\*bBh0h\m-]/IMx0 KJh~7ή^-'5DΤ_'c'T1!arI>{ϕx(wBC?(j?E{)X|Ŀci|I+)h^[PIH<ʂs鈎y@pq`7\Au,|Z#wZ휆k(`2-*"' z~YA}.c!%80xbkIbu鿑2 mp/rO>>Ǿ_&,J}IA=C}ylIoaI %|CTO(&l]I*;} 2' 3N\ArX4sGv7s{~d~*Vh ƛM8.S f-.QH 1ae xqF ,} loHr02ikF.r8YC5ͭiQ \=FIyy/RN³w|>8̫4 L6;!p 2'%`S4.>D>}FJA0ϹSXد\hx)J~HC,ۄKr?-$\ԮΗNA +>W"ÁV((Vlϑ c%N&A$"2i#ɐ)<$ME,2A.z|W>əN7PldJu=U9aK-67zNnӹ#q-q8 #HOPo؝IIdBjQiBz+Sҹ!Z1\`”8ݞ<~ifST=TKqy%)BޱZ~Q,=zZlˤYSZF1\pa$&5=ـ'-@EH[ŴvGdaI([/@LSV.5 ~# |R>sf}"X;Ak$2&KD<4mQANu \z[9Í\`O XXfb]\6SfW?s\PdL3&Z:l,:hAz KQVL̈́/hDD @S@v-p轡Kewz `ޯhd+wtRn7x1p帐I/%joX?/,d28B׎[>5ʞzM $ M߈ސuh F"ru%7;>@pЩj:hlzq(Td2I5ze`'Z_.Sj'[ɽ6NeC\lJP٢žTraVx@VPĂF&pbLɤF< _?*W;Ug:)*&VWD},w4@Z#K:)aT,XW @ ;VIțtM ݕFb ۄ$wOVOцM($Vi /hCt2-R։8?'1IŽDD@,vo23!vJRo6<'R;&::nW 3R?|ޥU }R!TNtM늪ˡФ!ZdP LR4zwZaNAQ#x%+ 7<kh Zy 5%$T0yo17{\),0F{C.688/lC 0mCf7 dQ %%$XO..t#ipi蓍5 uyb2 =p|Xx}}G]Jf|QVD\.{ll؜,KE 8v3p:4ju ) Nb+-4I@k@hO q$3͉I8x:vQH&24\)(!pxL>!D`&x@qYM"sn%^[pٷלa bk`m!e~1׃)Fڼf>;?Փ,v ʁ$L-ۦjjL[R׵OϠ5ߪ:/ĖP"w2$[:jL n9.fDTJ}yώ9Q7q?v@lvI{ /s-2f K,>A$|>tRa '#O@Sj1ȸ:öX%ͧ@S5K[L]*d_/][DHgVȆnzZT#JO7 x0O En01}G}[/l 47Uݬ*xwa;䜗Nd@IBd#wvV_[ /)fǻ~4XecG`G]Iw(Mm1o)h wN;I[{ڪ_PEsV´R=Rɬ͇aH_t0櫂sO4[ )Kqt%v'׵K`j 1ڊ9W?\N,qrI 2y17՘w ƧGt^䇪NJi1TKŚsK1yj+}NVG*2|}I?`Ym;pÇq]#|Y/v*+6\Cn%,Т]8%WCtgnPᱽ~%9~%V"˫fuν]p1uP88'cIoHpuN lfȹlӛZZgj)m7Cm>zTe8^il#RC QcNW-HЍ@ޗ\~vʼn;װ4'@pf$]eR}{u'IÎ/,Ԩq+v4\?y7IMGO6L$TM(8DHJ&G`p!H1K%~@`-}$ j kմFAe0 d@.:h!>iQ&lB^»cg6nXCGԌm?!$؆"TpͺY)x#@rڰB c_7ԽpE4\d%)]'qV RJ)&_ۼzgNc9ϿHv&}̊|:_EM&߃ [)ҳMe{j--rnl!/ğ-2*!Eσ !VөMɥ&0èW}2c%n,/QI`qp/z9&#z.U̼o!-8(gThHReȑYw^%tURqZhlƉ-=XR"&?/{N'^,vt[6w(J4f1A]V ^q@}†i0(!`[QX[c 44!~\'Wx~"HVZ[3wC!_fm& awDI\4Q3%'n5㟑o s W \OfUCϙIf ͈e*5yqMi mK14GOpG[ZrQ :B9.8[XrQAdO:ˉ³>7=9_G:Ltf%$*aߟ|p%,y7?5WEC:] pDshe7 m^*(HPRҤ І(>r'L8&.C/b wѹͥ,p#yϚVo p-5=yY SG.Q'5QtEs1GɑozSS]߯#phe1f Ab3HZdM9~'ȃtkOpJs; a!0(C?-NlqjFE e&MO+ج~A%5e$]?`x}$ls2R1wq6w}Μ˔v5)BnDVo$"I0HI.ڵsTo>IKz/JX 2ګ _nԹg&[U}o&p~R/!w?ESz8h9OUX rĶ+,TYc)%"iAMPp"ԠX#mr3ۧ|0!-עD6Sp+7ǧF|BFW8ORڹj`^OTnvֿj OӷÅ("|owo3OJLV)(D jKOJ^J}4v~"_DB6 ١PueaEWR-M#aȑ,wfV=UrgFOe8 XM(`!2vzUrhi7Z7. zd69joJzF\5$ %ǢKxP3<$f +膫qlDu8_H!X8@B{/p ^vEw+ALQ{OXKA.mw[;4} (nFjCD3/i u_E7e.]lj-utsQ 2|A% |?)9㭡=f64jڭCS ZEٰqk7 E(TR˵}bJC4U6`XшMCQPՒWpA6CCm/b: ۚ`7p?ڬ?ePhOTq &TL썑N i exr,okX60 tVXfS>\ /CJ5P`)EJ 5 Υ^ xvX }܉_@~ {Z(EÓ_=nҰ`.l 4ՎAmbli\m$Z>wɮ|`l[ %90󭍄^cz82]zA쟌[:f\Ajv`ǒPcj@K2quL#Kèi@p0%3}++A+ET6% Ao1\ēկ45h %18 [Y6YE%4K vqb Ԍ!A78BaZ=nikǙn+2!@tϐJ))c8` ͚$^`yZ0AJ c,@nI"A!TX>RĦgb^6@PS95,(!󻥽%LM˞h:}TOZ6Fe؟ gŝ>;69͗zaeaR;lmؔo v y~rDyB*#XO$./Rbi5q20iA)m5Ը~{{32\5AgVS7=[_y}8`JM̥@i P9^{M-/;.qG!T'uC nnG,u˗od^6(L\W*Z#>&a@K{5Rw|U*< JIP('Z3ʼn@˅h r^U>vGN/hF*eļܘ#+2A|@:z.NsAgN]8OMص\C==¸jVuB'UPg^<:lGg5Ck jDf7DﲲO[")VPHބ`[gD녝Vp hZV cy/ٲGHȣ /  BpzV|}k`tlqj~HIsg=GNjYEG&A1 C k9 Dzy T+ᢄf5MdC>;푞4"'$vD>gz6y[*, O]60۪[n'@+sM-8G[R75"7efmy1V F& `>kXX"C6FxܗMN@XV?oS9g<1Q59'!R. EvCtnfIn,c]ÒP?Z~1%SfhL!!uӉɼL$jGt#7.H~tQ'>@5t{߯ ˗ZxqY NˮeN}]mwKbM9Əa Waw jJ0MFunҡd&/[qE΍pn$=ܱj9 0VXEF#43 >{!(;#g^4=YQ.TLH1ޅWt"`B1; W2΅MϵOcyD?ngW6Y`m"AeH!0zgw}^p rm}Ƭ 90XWhkefU6ϱ.aJ3p Rcυa{;;:i/ 4;A?3ޞwXڲmW]M o;coM_v4!SB]o!0KQcX2sweے-o~F30֖Pu{9ȡfhr;8u^R"lpȅ>^RnrHle=`v2fk$6շ 84ڷ<=X@x s$ޥ,}<ƔepTU} u;GM=E(e\c@{, `тB]nWE:Aa {Q#tm:q%ǧ,‰k5P阷F)\/4\8tB6e= 0G܄ѝ'Q.c3Ԡcv0+apxP̢u(G\z#^%/UlodwWg|dZAs3o6-ъFB'VhSCo,7'(wm؉:)2'A;;9i♁ZW]_mZ&'I_B\_x=G(<z&)@Y棙L1@BE[:p Ӵo:I `[!/h@$/\["Շ[K:QIJI%[b ~4$Ø190M0F2:uZ%o:@؋3#D`?Hzq}vAhR3*.Է%ÂI±7=斢,9fæօC'vΉ^|0gEa;6`OLpW"vݔ:j+Y4$09.<7+>+#svkfR;x J+^if"qc+Vtå7JʉZ4{k5FK32v^Ҵ+O+f^(Wf9r2Iq[b*:߯F pQ_A،:kVe0aPʁsm! go|w)9QӸ/&"@O,ټybaQ;!cu:0.Ye'xdr58ƃw64FD*sfi{?4j5kc$ @t7ndȥ6Q0ȶG*HَuF,Q CvR 7{`>tbA=v-8I3WʻA$6me Z Woq;Y( @ăM~=lp>S$pXt~cIR!B ztCdw텴ͺ!"I&+`1:#7 `eJ ̏)`*{c~ -۸ 4cq1.8܀P)2Kc"PPGI?fD)O&&#lbIsV%;=3fSOa WPMAx S{5Ckx^qR WƁp -IݍTtdBpd* 6?i~)H l?$Vd~NJ=hNmK#(S] ͮ0<wT$B$b@5@MG(`ҩarݫi14yi[d ͔3zk1)K颋}4'E9):\F1 _=YBBBՇ,s[F o$&8#8VubvbZi}TێXΤfb)P4:y3"5( M93jezo!4k(DvIyP\p8L|D~&Z ,֛( pᕨm=,$g% u#կ&VA<T;4o?u}M1*>礓OX OxOyǫ7hd9Oѡd~xv Ca&Fmm:'2RWmP>&5' e;o1 ]T޾d9skr*[6,IдC\3~my&q7]({:\!Uq'Pz Nπ.ʙ{Pӽ~ybKC"-Pǘ\7x^X<̠\Ψ}8#&f1=Uˁ+.BT\wz?!TD.W+ÎA(2b~THcX1ԕ= _Ey3vA^fd~&hw*41$]9Ndm1\7 l *6 QrXjYJg ' -Ɲ,~i~Z~: X ۱Vz񑮌*`90&|aYf/-ŌxQQXZ:󦉠d݅k@rs+FJonm36Ԯ`}kbN!NAV \/Nn< ꈏ{ncmIc ;^}Z4[b]<+IA؈1ї#p沨iAFIL EJ͵c\.|C_$l)۪l snm1R>3䛅|vm l^ K8Dd,& OP?Zzv ;\ݛuCb窣 ?T'=]-~ `vC *8#pa_ݽ+Vc6 3ZB!t%pZ(&U.M|FQThK Ss1[gx_(lɥz=YYO; O{̧!<g+69~Ӝ:}CS'YGD bZ9)'C졨_gQ< yfݐOҰ*բ;p鶀yDѣ-*.JU*%4s_ڠ,O S*."uB<\^a:*(O ۸=NZ:ND6O|>Ӳx'1929~?UA #[M ,9W~=aqQM)RJ^8oB<?eK#NE#ض~!qрĐ~ഒ/_'<_>8TS gK{a@ ߮!Z]pU9#Wm\ǚ_L6=2[stEKE~q8n 1Grq !W:Si: k_sj \Z2(O^]PdB'ZygKڃ%Q0H<oIoCD)5è) U]e]4=5_׊UˇP '{@ilwZ_jSW9 AdQ1Eq[6_BtMpYD:i2dqp'꧕ r!EZߌt(d[MʻyqNs]ivIӗbE,Mh6 kg bj#Yc3+TH xL[-^OqJ~ 76i x+V팇@490:[N$ʢa!,Qp2v+yjtL$ƚ:wd`k}K C&P\`yY\vKSjcrT%j_*@˴a~_܊ |:<bw8X**/^XCt(2d*o5iZuёp.s_}>6,Q.5D:Y7 e&NTہ8m"3<@@$&쬢T> ΑK\/f핷d"iY )k3&Y1Oc]Π' 5PZ/Q υ%m:G<k&w>覲o&vaέPϡV(l,fFA]IZ`#(&ڋMyv:ru ^j|5Y .r|tW eaI]d~i-/qRE}AP{`0ͩ{۲e:ZXP#KJ6j=EY7P^ y9sI]),1A}0t,_[/PY.bg/{Kr:vgaHebK)E_ƕs+&%O+R27U\?|AB:}Hvؠ+4i~g )>]k'<^j(5EjGy *JY'C!s\`*)iw:OҲȂhR*`Ւ&aAO@tO3Z/ݹB։T8ȅq&}/ǹґcg٧fo{lmGܧYmt9v.}x_J+xր#2yU`_E')Z׹6BWܿ1!w! 홦3p)l^.@h¼ICp4:& 3)U{R\9)2.Š$љFjn3pqX x˗j] j{iFvn^>T kڥk$\WiVwPnoqOm.uPro̙@](?( !rd{MrH7a14^u5 ~T7,Z7kE2Ne D~+QXJk|܂ښ?@B})lV'$}ѨX [Qc(j.yC ( i` &&Qrl7P$*d q% bG<a ӛ<} I.ZsFR~7liCٹ;朑}yY*W\S$v#̃nH?o悑O1@Ut٠m̏Ʋ莍88Cc9k/+)KOC#LP΂(dO*B}W &q¼ L f'?"zqG*u&䳩$hwf oTm@6fU3<*Z㾖%!x^..Uv5!=EH8_:IGUDbP"pE7ke:nh~kBet<~tt^$1D>Lt0;3Yмȋ9S"\ңgӺpٚkf‚*>Sd {b2!SޝPjuc(7(1M"Wb}_7bdږwx^ W4`UB 5/w'""Cm+̿C2z.\Q?Yڍ kn%6e:%%frBH,{pb|ޠ,729'%#x^@6mԞn \LÀS#A*ا`Kť^NLb*lHJwCfM.(3Zкa0aj+r\\Yj$Q ᮊHA$7?(rWOk*-czn:lk|I@Q>!7==:VW<8v\9Ȑ1qa{ Obv>recAM`;4# AM2ÌcܻS4#:LKƍ(oڕ,W+2C`֊5]dI>i1S: ׆%L}KN55*& z9>NT5J'̍mD2puDT .AVj]=iݢ*{ _w!Tޚ= s;Iz*p;aмLuȒC!jG% x[殞ԂAEҀuHε2c"t,U% mO|Z<PE (6:.IHU'KDj2fh˕D(6:O@|1&Y-I'-4LdnRȴ^x'k FW'*ebAέj)wuQ:Em.˱r8;91Ɉ*Z: Qiو8*ۇ Jج >0 YZ07070100000463000081a4000000000000000000000001683c5cf700025b7c000000000000000000000000000000000000004d00000000./lib/modules/6.14.6-400.asahi.el9.aarch64+64k/partner/net/rxrpc/rxrpc.ko.xz7zXZi"6!pU)]?Eh=ڜͩy8zNk#\[&CBQ}x6n;S.ʱ+x_zD/o(9%[Z<\n 8*PO$eAVBŲц r fҿ0BQ:M-fX0h?4|>2\`|;<:DD)ٌɎaGf#ʲ^q=lk>c:g%~=Nb16f O .TNM%ncX+Y(oiD.B w8g8ƙΈ 46LXEAW$GcOBЌ2\LEEjY8XZXxor+(8h0[oQ\Nrip%/y3ͅ|>fzmSNRo s[ӏ2:?\mhNմT":u(?n`M7W1bl eȥ򿍊/Z[&699t I0:^˶d@dd'̟}.J-ZhqΆ$!C+RD4]Ȗ֎ ¢+0}^ͻ#0J`g׻鰁M>Y olnA?G7DX)f iOD296r#8}\[4re Ot_9RS^D~]p Bvg*^yX66؈ꄢ-'Pj}tTA)4px1'o? 9Sѩ{O܍fOƟͶ4G:IHwd_wDBS{E(U׷xD[l;ѥCȇ% 1O8E!%<`bhȹ7syx́&WKFn֧'mM۠%)q?q*,{NBaDsS&ף~4Iӥ|.+x}l !3BT45ʙ*0 ;{vw)ELEm܏ EKTq-ͥqЅcġ6FAޮsg@$Y}8⎪>WʔCB/megE\AH(6ٻL!i<̢֒ x %QoX"IƤ&AeԛSH\u" }UY40Nv߆K3K;|Ec2y#+lJ\T'QGV}Z % %ɔq+v ('YQoחҹ#(#B>>v&b\ucBlSO#EK5 [chanPXb/R(<'?7?$iR ) V`=0ykvS`CP2WO~{UdyYHS/5^ǥ.X5Vs'Nw> u{-|{СZI/F?cg\8.ДZp(ea#qGxDҚXU,zb35 Ir;4F~8!a#]6YȗKN§R:́ȴ&O߂V-49KmŘ.Dy+1"mT"y=K/j`h]dFR |QѸmˈXdz^<9:hRPq6 @_nNjcLh ]zP ʁ xY2BAb\T9t#:# = 6d W$EԚ*\j*F>ʶ#̥w^gɲcgl,~0;&\b"e>C_t**su}(5 y;ZBFKaE@lp)DR#+ԅ cHLHfڙ0]E Ts\ZX\sӗ86@ ϰ1+46*KwYknu[Ȫ&:lỹogCͽ*^=w{sd4[`;*lf94LdZEgѵܛzagp[͖2qbrNO?1'd~Vio%d^x~Ҝn"VNpPV'z3Zf}8bfa$hrqFPAXd@pIR_6Yf|,V\IM1 w,K?r9#>k@,x^#uZ*zfmYRWQصIƿbB0ߌ䚠U%e49#;x| n9t75&Ⱦ<=+V_h~TMϢrQeIERB'a{lsH.7bjXN[8I6O~)i/[~1X]Lʩ0Ke,g)H蟀2.ɧɗeI|ޙCfDN\zZg,׹O$7oϝUo|%f2Iu$gnK^30͟^d7׸:ly2ףP#$p h"S8iS( U{aL174{aa!nj84Z`p}B}%1I\.M3*)ځ()xl"QoʑjM)rwH@|OM%4:u?O#!blTD +\'kdn4/pރTEA,T2Y]0\,zt*vUR{:IpM9=$ w13TZ{ZMu mb}kό"2f1&l|)w*'5rG-S=( E2QZC)%Z#8$zwi ^:"0qoȉO OA3F1y߆ :ÊKUbT1L:{#-02fhR7h0-dPi Bj=nÊmtRxQ0q*#]u4`? q$&F S% 6rhtn"RiuOn4k;RoT G ?p(QI=0M3M t\^^Z܌ ("wY8.g.Դ |1m(kӿP*?Nۑ6di׉wT:z'` k$ٚRFM1;%0䁨Fs6d0cN5\fۛW<7Q"洢B Wg_,c9 )3 44/),u[BK-^b }vIR:{$b6W7h'E7_"G+vTS}(!IӅBŀ6@Ryep-lܰ6 ".LQbFʛ $XfAl7p{`wz_o3ٜO+Kn;a[Wlcuy{ ~!x߰k`do7PO.&k\0ʶ૕p2~G4]>T{^mѩl:)YdoVa3(O,Y(̼3Үy29ip aU +M#;lmP;b L^k~N+iJ5weEw~\$E@̮.ul @B<4~ ORTB9CP7]iXВ1}-gh4t)"qJPݫq#>ŞAK]Zr%޴SP7L_ӊGNTwZ?e&J("O ~57g?kKPǣ}Sv>Cq$2D8ebx6T31X hi~}5Hv䨗'εۭOF V9f7q0܆c׿I駊v6'a^ hSha(DV34jō^U@ꆤ=b_YHWE?j&P*tj*Վ~?d]4P~!,D(ބ9?AF3h"߱QAiOCtPʰ#?2lJr:I3fSL<@c9QwBٙ{V<jKVTWm YfH4$=SY[ (/]{zjOV'ĕkJ]R UndtVGCI&U-jwoR46=uجJĽ%JpLpXLqҖ]vs CnǏ *mM+ٙ 􎺴"'+Ia#AS$Q76ﲫ&Éra@ЪEѨT)nC5sQYwLc>d} x(@=rW߷>Y#-rtڝfjҀBk.;ExQL1>'@>ό7phgGǨލxNƲs\_GʰՈ! kv,(' -:WU2*l],<. %:peHyOP? k(`dNE-c78qG&=fܽń+vrB8%^.86%v&"u:oY:KEZ8SQq݌} {\oa'<dƾxV0je9Ɏ˼ͭ83_4rĭB ZwI}vxpQ)/Ƽ{Qcvh0x5R*|cب" O zRn#%z|$v$/C ny S A\༘'>tUuJuZ8^}x!_'b}_}>7Sv9..I(@&>[92 Z֮tWK87 a;ס&>=#X_ :KǠ{*%mL4s)_ji~_I创DW[,D->];aF:AAqH+_q3"$+a)@U}i[MI4QF0fr9.ч64L#D,ˌFߐ4y6]̉"{|\@M}l*?Qha!j%dR6S׾wk %I5NL%oiq`Hg(cxN :i^\lu.zC2ezpd$mhN-Y?;70MTY sۑ_']S31T㷛6-tjRF, !z1l!)<Kyjԣ#'t*t$/70@gY8#v:Xlp0_HB{^Ĵ,~޺N/<,nbfGs&k"7we1VӪ o.kZvM# Ho'-) FALG䕢>ZRۂJ(X;4~ X mѤ o=１Ea8~8Q.:Sy L芊}DgX=+NܞNM"UnT2WC`ezI )oO8`[Ba\yNI8JZ?UP\ve21>0r}[WRQ,ZV1IRʒzXwt乃OqNgd~|~gt=wi I(t6oL<%.' ZoH˫  4|A|PKԸN1PhWR:Xu+ܨXN{i<\F O _`5Ք} *5RC ?%f!Sq9~ m$T)-VP/s^p:].X_]|jv-EߘKŅr\ Lm.U1F1Lo~jOM=-).R :k9xMv'gPBY,YȎqW⫶| Œ6ztX--ϗ*Gp~7Ozڴ|sS1ktϣUl-~wݓ)@.ɴ3>H v,hd@ ]=ׄ)>^T4;H%uxG%Y`sJjMRIC]bT(eW$NAPb.H%I`!-撡&˙Nx֢;@<G,JAZ3uZNGuEGy[Q 6TꑜAu)/EZ==`yy.wpTvŰ cpȴ)2r;QWJ/BbrY4Rg7(Ky}$˖Z=VS =5Q5۳EA=hٙ@BR>g&#C \NƄ\Or:Jev|ou*qttF!v\duۡP(ղ[*u.l6Pǒ!q3u`*سsC}1v W(TNi Ǒs94|=K[K37P3źLz}Z 7)r_WlA!dUy9?k2Cui[A`"s.|dDkƌ'r|j(>c8yvKNۤq`PmV꒦#[; *+4rG\*ԏ4'TPs'my8OJv!Zɫ,R_߀uu=?hԪ\u!ZO:jNUxM( u V.3:kלNQ>kP ʐ`V OK,"k+jϛguc[W|;P~` AAy !$2:ݔ* TNL$>>/eѬbR .vx2η=#0KƍÇyw )_?_Z;{L ~k`'XTgݎ"]so 7$4jxuXG@@,x̎sDoz|[cx<@vz>Yά*GD;tVRY!ZcZz=Q?3=^M<)t \];0'U=HO;~Md b^֤Qi#8܇"3Mu3=vJ me񢞷YӀW i;e h/6>/oT%c]$ʒ,3`譲M# }I5b be826 ХM{R+;ͶgQwEtB)HR# Fwwx@-=`_۰t L!Q;LO5۠`y,f/H9:^HFB#NlĻبg y`w1hI/9[Kmo h]6ك%w%${'nW`#0[_fR/3z@:30'+[a }˼a4]vKD˩7c%f9>*wCQ-+(qջʽ 1h,(G'=^_U'n4DT}O!<ݶi"SkL  ~ `@3k{ϔ˯gCV쬧#]̇äbpwp )d1}淿s_4qGJVΩե}χJɣqf۷jwaډ!XP/ht3Y?~i~x$ b1ȴD XJj'Wo!%\gK2w's7/+`)RJESc#Rrd85(L0(6,> N'|uokozU@Dg([EǨӢ(dC殽S.w*YiÙf'Zd'c1iM}=)v62+SBGaY_A9 [=tgb"Qw&P*7u/S8/-k~c~aԄr[{`^ct`xBK(k8P>D "ZTL* Hl2uZ 8yec тd/(f_Ats͝CPE'=/eG&Z1R 6@54e)|KN(FS)Cuȡ欯pU-?\Mt*n[bT}f1aBpX%g6'ʲ%m^FW<Ԙ:5pa+E}2D4P d:nV߭XT 4*]CWZωn+: " Ε7׸fk!61ZMQ!F4wY堝 %G] Q"sVs_F5A$5F-K{f>$9d"Üzxx^=*`$4IYS8+VNJs-3 {i!LʡjL{mKUּ+xW769&/ۈюmk-_,͔7QW5ʂF uhC57`>Őn?įGe`t&%WZe\0ӵu"\u+h& IBt@&\D]( 0"9!yyd`[MJ.l~Kk c#-B31l[C=3z:aT$ZǮlfxOҿէ<ox 4ZPT߯IH$zfP7]+T~$mM/&ݭhJr.K0ϨZ_D>ep3{bRC0Ptq=|7%kvHWy7A w-u kd%D B] -5oXM[aHgzC:"sՐ/$Kz_f5g xBWD渲*Ih;Lh}jF2_> -Q;hM~XVI@N`ŋdtALLe$ *ž R uxYenKU[ 'oDҦ +An1tU§RVMwO1a&cwtV-s+I7zhl`OIr^weIL1v,\˴h8} 8ᘝMF7)jIYre*Q&~`bXaD?ƒP%&gXp^6f#ht#~ <G˽R7RWyw3Ы2ϿSY]Xf)~c/\m ~+HqGF-qiuҾ.|4 d]g MGn*}S5o_cK//K;Dxri|j0Qq`;:e =aJZyVv+ܔ@3f[Hȷ0ԫoHM:2QXlL;zU7 P|nVBρkXlU!^ _`AM3JACSF[-sc#2z]2 5*f| ^|ŨJx-FTS"-E>vstƃ-7 I>2gf.W~(X99xR1qm U`Z9e3+a1cI_aU9g%eVd։<مթo׎m/)y쵋q+$>ȼ:##zVꌀMΕoK vA޺N]nӧU|;sf9)&g”;ga!w;/n9>c]a`3cPN_)CEoNW仅u/zk{vMؓ*V#WOdX曾ް*}xtc[R7\9dz.8uV@M ǫB,۟Ų5%O%tR1AeBӂusv^2HFh>~1T|-ugΎL81 rRmD%Z#c#5w*2W:m )\b"A B %[;"a!ViCCKz缃}39":]h{T%t'w  a[ncv/-%ɣG2UC5ϠMeS/x@Y&ƎB2]>!MI;G(~H ԁ{[&ۆ7-^+e橗ۡ`LvųFZ" a. +cX:;V0/Bf]֏ rL^_F:=I]Q8lFCEYE s0Lъ[>6l[}ҹt>ih%E|uOG؋1`W̽=^|Een*~a-rڒk2<Ğon2NfWw{E^ЊQ#uت9r@#Daڮz~a#V\OW9J^/PzK&u 2f"TH3ƶz[i-nN׺"}<2@6ވ~f[/ = )u@s|7ra~LsҵoXT7]~cV._T6w=P8r=âSeBpMqnW]gdb,꥟۱JfQ}Ԅz0ؾP6aPt)@;NZ<5cɮ1J&[/㦻,{[Lb"_J J`,9bk蚭N$۵NxElc䉚3'jD,Ϥ#Vx?;㵆F_;Z585M\\>q9CI_@ X ƞx`}_yAf&MI7.HɊ(w'Eyn7\@#`":y_>VRm ?0 G9n}fUlP Fe"{raX׀ 0w:l!ӯ1J?aq}ev7hUᗯHq˗(B}Э\HinWS1aS﹟T%@ $;2z}+@߈6Han`j`OQ§+REdNgOWBUt\)k8Anf !I?.lr/e]Ϩ)} p-up_ᐜ6dK%YV+% GVu :@}sf/4*}Q^2yF, P sSkhKg&Z`[f@4ERn/ e3bOO^?Yϋqx=}IrXF|y`ZYyI qY78[-ʼ{^d荻9!Ep$7G*RT 6}h7p+Drt:P(EUZC@9 .:p{ g-?ǴJǎRgP{V8kf:P+ wfCOvvkg\64NA 9q,$(;i%\BG*"9c}rꎔۃ'L5G ڱɢ9. U?Pb ]Z'6K;i ?g("@Q]ܐeu׀)c  Kc*glאQ[{o\;,8wO+B Ɗt:w|#GJWт1 t[n-P2' Vp7 vC3Uϡ>GIA;Raa1m-c,*]Bg%!'3o=H)%&Q_QP[-&|R9|:dJob"ܷ5M"Hv"K-wez~ux,ɸ9qx@i 9@?kQ/z&c /ǍQ,&xZ~!D=v*ocy ^}IGc`zT)|U7u*W3_a HA{^|y֮'vu)$V_0fc 4?P;1W~p9ѓ֢e4m6˘AR}fHs!Zma]^RGMZ]$Hc: bР*}I-tkc&qvB/JJenlF _RCt5G]9CkTt*eq}] E+); ч]j;d}+ӃŊ&! [C l_$ݭ]w6 m+uo=ۙL_n @1BkfnS?B>l5dӂarV3HԾ3O#A ijyTF}.y$w5+ rReo/umJ!2ъFVosP_e{,q E2)Q6K'+*?11eAZ[ @y*Yg6)Yg4Eāu:.ɢN"RxpH*XD~JT "ϜrjTTa VrxTPCIF|^70,%*a>*tD ?gp=Gּw"hhtONGW-`#X=xa,_ݠ٩G)ߐpSv91B 2>AY?E}fy1/puK-Ҫw8#:ZvY JӬd Yt0`ROr6D' Bf++nE8_'h7ɬN#²S;S gxn(ҽ8şj?ށqf b#lTs{IodE?ԥdk^*0=2""팃F}Gz=kQ% 깹aABb"Ā"f8׵+!#XeZ479dC=|w8j)WWF1t.dҋ})˛L#uyYt^@7&OوK^y]x3\ʀ7!z'xN}PvG2kWָ~-K~nccɹ+q.d_-ro&ZT@+ZߎMcg 'E,[x\b7%c G+y0Jw[X J|Ïl6[.*iE>l%\`׺uS8'l&2).Nhkɮo]4oipTuɈōf=ck/0p#<yfղނ@\L T>y}Ѣ뻠^nq/fR\Ct g?/Fɸ9h=p;ϿPȋ"Gu ([6ZaWXG+ rg5J(N+LINHb<ܕz2t=-AmV\5nP(c߻F/\"596T#Gx܏IQ©)d7-1πж [IOJbb/zn% 2/5^nRMi M`Ξ*=pf5 !;l<}l@bqҠfwZ$UW+y$M{%B1oVvEbM_FEV 3%\*SWQե;AaWvgETGwBb W4(ù%>)5M7_ZV( uB @??F:$bR_ ^hk5V$$W&%AS†I :^f{7h?nyCPXLX >~mHU`[pq7rFULRpvGw=6ۀ . ~？#~ln&hki<`PlHiMj^5,tcqhIem<]u0[0_f;0tGZƪlޗRk0½cfw>~ڝE>զ) (k]j6uO5*,^ƽj=+2>;vz|O+)`X͝q1(/ge[eJ P領)*3ky N ?ҬYDa7W/\NPt>dpn~޶aN?CB}Kzc^QWGt܇l%/Rh#A) H"k4=?!Ul*TS)c!c19@OHlD^U.R5%Úpo t0$^Q8h`gtH@t1@m]8"NN-)3M#ɴ댠}QHtϋ~ \kEktge+uW3 IӨ`t#b gV+yuc^M mꌠ~vO5t94Sw*UO&Wr2Tnr/mV[KDhx10Ĉ%pxܒ7!ih"6ABy\lJ"1TD9KBG- &P~Z~wob{͞-9Pq:Xؼﺸ7[ 6dmWfMr=-S+ZBhqkK6Fl24O;zyفp3vj䢵|om$0Lif>"Ƨ`ncdqGOnϭBy5< =cfq0A*Sd^`z;$ M'[ʰUƚ7TN#+%%.$HC)ɹ6|(K><(nt,3EoeZ_WZ]8QhAz;1ߓyцWHh _5*\MVOŹ5Ѳ̷"qgK^JAS-/_86bMHT+<2D6|-]*rv2xELV|lƱ{v?Gby(JglZzV.@U)dccZ(5nss xj#7U(IݞpѢr]s<)CPi(U x%B ^TOv*gcs#[Yi M |d405DN5p0 np_QIP0\;>ք'B\GQ8#=XnH#͈ݣF(Q@G a^ᨨ2_0hJN]O$̴]C,3}I;c= "#ni`rׄWE"tG>$߄$>WqO[̙F]XuI(LY fIͿХn1\!ݰEr,_x64u|Dqo0*lAsPO ־וyI)"Ekɚ2^ )o[rѨNf< !Q~[A׋>xJ-?u^8\J2 i\hXĘqz@6͢s I`DwLZb d>X軔rlnҏ-G4ڋ" sC\<,kJ$<N{ە+gR=UABX!zb*Y_b4j^;uQE;"汋{ʉ̛A>8ɝMe?>:S` Ă.`N`6w])Qs\i]R?[,~p>hB>F|$ƈ4C JR=@3uL~T]ts3JZ [ꨰwKkM4HRR X*aR7"v' ,fIհ}Ea/uYɏ7/h܃h-V&\]proGp4=R>#+oL \j^Z޹B ?k^b#(5:%:S>Mu0ǩVDj q:JC$12 a/1A˾)[70*ֹ8tHۢy2(L>xi-\USlUg'CysPNAI4eѴ | ,Q~T|d`P5b/G0a _9@X؄zWڔLtKBn'_lO+D\nsy,*{8t! 0;8'=|wJ&ΨKU L:.b80:Lr8aV Y0"4Jc-jT‰<6+R&u]~D%bG``.ϞpFzl96g#Ą.XX805AkuD<صNnr~Sf; KCMHz} QҸ')8-3\)7*kZ% S`2ď [ICccTůt\xQro^KWITv# ,QOU%Kw~:%p`T8m)T Z1o#VtfjpIfQ\ĐEX9m%@"axl4pKWWI;О:nÛ2JD9tp.7Wr `ٰGCƆ ?ܹoT Hb$T@5lrc{GCt6^/}ײַ,yg,vR]9^<yZQOiw]r$l*ei OzNYQoiI%;Ô_;B BK.}Y 7D1jHY#/zmkg`ӿHXfm~¦$NY\`%vy2˔mo:?z`Ӂċ.AW&Zvz]&nvInKAhf܈ڸ!js匇׭nڨJ缅O2㲁 :?;v U\ 蓉L :Lw8~%9SĤM+8}QzHgENŴaQQCL(-SMVy̹ ^]i]޼ģb@R2u⡲H[X= 9jqV>}Fw7F=Ц_JA&xm$]4F%%vvVUQP/*Z]3,)ƨP5wﮖ)Cە7t}.FT6Ƽ bС9#ܴv%d/Y/Y=c^Zt<#,ڰ@ Vk-kۖ1jy&FORJFc?4ڹ{F|l' } ɖ:'a૵Cmͽ'Ù6qbYt`U NIƐ^!Mxŏ `Q6~# zx Y.E&c:nH3dztgѫ߭%d@NdQz~P>-m/93SQgh-M~kV@Pίۤs=*e<˹KEdߎҍ$AcA ] |ttȒ5ƁdoF}v噊ĪOK'l]{2#QѭzcM] IZʨ/P1tf0M9Vҿc͋E0C`!jѽ/T3wbs>؎K-(}TDb.&(~N-bj-zO2 $|j}BBRioUnsS;.i 5gyl]'{lgKӀy0)J`713 ԯn>5$R PD*+v|3t#c-D2*`!&ʣ5;3f-s=/6(Cd'gG6^cf~g”х>Y:r[(de{ȒιyK\Fݹy;>0;rz%ÃZ4<[WSʺh#%Z+1r(^@D{v,o>0:gFwφw`5ĊXH>X }D_nkZr/vcfdk<^gAS}3`^{Xahg/GM.UM۶\Z»h~{b+@C e!U^BtdmQ2il19oa CiJ;xW%U1YVr$Νs' O^)H#ПUAHSj_䔍I|2%P4W>MLhi;'G6ӭRL5)mIk*@s*c~<zA@z# ?nDS鉛qpJ4=p3u"ɲ[۹u]ruZj%]sd fڐI#\azj c@M`(DDZd5 +qım?J+&KP9:2mm~NP')Un>ZL,4Ȯ1yᩙNc>`RAȽf'rYZk :u)TX7 νi'"Ne!2eVi3 v֔EP9$sT$&-c=QAE-POyu<\8qGq#3 qB$0(k\+ŏKF\z,_m6uTlx>K9DCFbII7T3"(:ad8xb$6ȷ8*s}r<> DչR_ j7NzR\,t^ȃ/y#+hldt&»PvePvVezk"afutۆ?X7!z9EzRC_,BocPXT8$UQ vJJiKS1 ^ŷ8JE5h'Y\ L@ViDnuvXJUu"r:$wZ%h_CP\`&Pv(H L1q2~ ~V4&SoxVL㸪K C|XչTi<66*zBϯ˥-+g#]s|)b4)/13kPz&^-ې~ZpKdpݱhłVY%# `jgySyЕ3N08](cl]h3Ƚ7r1ĂP}%1zNjefclS,'6JYN\Ne2+ 7{F(C%ӚIr޻/IuH+ubx.ҹ1V(*K})oګ."n={y--̒8=!\4UC﷠qܒ,nlK6L0l"FKxSh1Fg"I!dWZ@=\_L03L1lDzo"ńW ?IQ0x475Q)ۘCJ#7>HQeQ\/_)О!%CPK*AlNufJK6ګp{a\\bil}/U ^4ؽmvU4N4 %i!/_D=åiڞ%k4j.I0h{?gՌv(PІa"uzR`,>a7/v @Z#f}u5Jb=FXJ-@ ArtHZ ?umdXAOnmh&Y` :EO)#n|qS~bv2ZA+|MXДrI k _0>1fp˹c#p Dy^ Hֽ+jꜯ|CmO()Sys{%F@Ź@=,ǐ+)(vpz֔ԗЀ9~BEX*MdIچ 8msǕ.cem8N-9$9sxˊ ˀJ*B=WJ $~`PcZbUhe4ۆ$3TMifӺ 0Xi& rK[7.Xg{c߿C>|*Ub 94#zhLhlœ^gCjި_PT7M1;)#~β~I!tc'7Dr$ < <%OX^،qrEG>̢ʚ]Rʴ4CQq7S)%I;HS5$NL5 DcLg UN D%TDS* gm|'Kb* 5پ.(ktÂ,u-oH6umN6UѾx 8`M1EvkDJ0oB+ mc!)Pߍ^d?9\o|ںKGz{P3$.ۼu{ǀWa2¿P8;@GD rHV&\j +7+F#<7Zם}Ta|:w$;kb?=8Z1[i' hl8A7FW ~)ΟfWFv,-Kr>k3LӁ%K^)ʴPc@\}y.PTd^OW1㘫oR/)v_TZ=>5 j5wu;^98&?vXKO ;?{U(ߓD!#\:׋˽4a$XKmˊ|`Ҕ{lLXa:?|R50rdfb*1:m9a;׫+~Lј^}DG >mŽdY?\jz1Wz4Kv;jF V(JwʩpD)gHfȖs#f߅ mQ t@wW\`J>JO㲏.-7n&{-9<}mN,K X攟RP_qEE^@W ?3_#L ŸzgqR~l6[W&]1anՒjXc[Sn!ٛlG`% wx& t ^ѱFBZC cy- iM҉7"YD{;1?{ I"a8;rUm=XmF.T~:ثo*4|\Tƪ $=2jUB^0~n0:N3Is˘gss=J ւjR ̝iʩWbv۹PlLȈ˓Ğ1pm†0[)i1biw. ~U]7՝ [hQR<(+T\割x_~bKͶomNe ڴ "\TZv+h81.}ɯB*D,n4 P1uZ amɚypg!ta&0d$=lEVC"\AϒVV$`Qg)Wl!mMDC"N {@a'sL/TI1V`}Õ'* a-~, J3Yxտ= M_WIԏ-ձy#HhoVWm"@ݙ)VH"TqǗkS Udi޶-4,}25tY=]8_p4&ݳͮ}2!y'Oέ.<N"Z*X^{aLgfH!$h3j& H|i;?Y/ !0T8B޷ I{@$ǿē/%eNwDƭ z@*pȎ3 cԐĜh ߗ6~DD3$ 2"Q9SI!.-5M\eĞ_k;P#yΎdg3^;c+iW'Z>"Y)+[ˈBܲQެA #Hf$at<#" xSX)xgWm5ܰ;YRCQhZGȌo43CkML}Q֨ne vB~>&|R6,M/8CipLL4p[[5QGs9p#g"e7k&k&C|a,LTH$cjuc`NW灁\TʼnkIc*!LQ(g;&< kvȒ+ yad,܋Rm~'QX cȸ}EVpt=}*sqnZFsk᣺ցo} Â{nkq%[ tzO2ľTa?:.6k5n&ֲ6T?HYMW.( *@{ߺ>CHf3`06 uQʖkf-g%D*PAFB^A's1WmUMVV(h]E97vTgH媱O5 F$3*YEБNZ )Wm)AA8uUa S_. "u̦{%.^aIWW^ i)emL:C ӫl|4[UF R:,5=.AvĔ t-nHX'gvn ==y@pU~+VRo:w b@'^`PGfhMla'( 9\mK)g# #ꝧ{Y%cSzYqU|s sCi7M ǭf-ˉ. d\6ImDKwuts#IO'*uRPi3E)=J,, UG7@(}{i^.4*:`N81ؤ;@3ޗYFF^OqW%5&nrȖg{ۅT+Q)]IM5.}o e|]42ˇQj/(ΥymZQdGߤƕ=Q\$L":`^_GY7ơ/- 8p"T/::&P112˗v/ɃNZkB#I(MPoZ)|HºXۙc>,ᠪR@WV )}/iQNq]#-mf1~=!H]QV|4=ʼnsd(EuDebmf}1!s!ﳏ[~J8ñeNIN رD1 #D Wl;̫\`9j3<_$U!Jz?g@\/ oN^-oY^AtdNe5r C4}]fsXhe-VPJDզ7m ( $P" :'Bj;,5䩅@7.Pu,zj[aY!1AT ~apz\:_, ܾL/AO oC XfM;}n uda K Hr2 U.*r+BqĊ@}/f9Fզ6PEE1ly ($u rs9D؀zP8dKuܾq;}nTDŽaoŒ$$3 lUŊp)V*dqeH>~ ձT}`ki]4L5Q$?ȚqĮ}:Je⦂hBOI sKH2ؓ)"gbh+U_k7n6o<س7ݑQooka-%h tf!Dk(# VD+Urҹ{+ɓ 1=#ZlDZ l6hDnNB/;nb841[Y%&99dN#G'刯t`Gz0U-!;~7ۢ+sU0!u7Kso5D* +tsޡzGNF oj-SNbw2O.C&zʪＪ`u%nJs?*q+2>*H."z1!0ñS]3?轥/5(H\)^1Z* {fbsI_茭T_ 躀DḤ>tBBӥE-9ʕb'IJ(;L~'[>W,7I?XudsS^o7 'b8v*IIVH/ q=?+ZOW[ELE ]2Lni)pg6҂JlBy3C=⧫{rUL.ɀcM;bFd A*,l|层a*`/C1G)j'ӡ}pͅȋSշ:P+4e.C d`\Kب%p a6O C][OR!9mFF"`v#{UtA v["-9-Eѓn'W([+Y~D <ՄY<}K}LygKU&-zF+>+]3#?pU(Ry h?J1$Wfg@4mjRoY%K a*Jk;߹͔u^Ůgf;.IJꋛ4cI}& }? F(PJ٠Bk]uO{/X!Y{/Pײ&ӻ:O Wq ?|Xpr SN0&_ 9F~k: #\:iu6P< Rg|@k#/f/&%O!= F 0 _v-mG@΍ w9Osflx`L"#I'94Hh J^ALbȏqZ7Ȑߣf:PPYx*u]$B:l\&3C$GUe'qRqplU?(<۹aBinw1 LXL)Fh(w?C8C#WctAvʨBsn1:ӯcJ sFIǪx'SIлN&iM|Vny(oKV[;iVwNQv`c/|&PdT4B}:=aqnY zRp7ԁ''2l*ۈ0ZMk3 h5w:JҜ?hg0SxA ZE:[.ņ"M(X XOXYSb:#W9ll;g$b9,N>7P&\ʪXdPWO|(CK hU=0;__ 'F؝XK =t΁PO"k4{}!>i?hڹlf^?dokt>&]?)b96A(gGطz1) "+tXhTxB[I>H$F8ZtƦU[ t>NBV_r1G4QdU&.|oI47w{9GTh[j5ӛY5 \(Xf!c .Ȃdn/C}Ÿ<#:ָXSʃ(Ug+=>CϡB^Әn)j aůREYDˮ<ו|(U_$1z Adch>!`&5LnC3Yi}]%"۝3i+tR5j.}]+<$ZMGMǫ" ٻi \w7/ wO^3;$=ChfӰCI]A:3tY|G`aM/ ;IY]{œXŧյ8!QEñ6jON7= MR&ɝQ gIF?*'a0Z7 LSp_Vkʉôe"GouيlR]ؙ.hiuP,8BS1kY]R݌`#i[A5[;^&ĦljZI\;M%;/Q~,ɤ8Gx%&h?r +aw3dTXc{83Nv<>˦3G{&WYڭ7G2P=lizެpZ&%#5Mvye8؏čM v RDn9*GϫjݗS[[!g  & !+G!#HV1 ae!Է~h0E:IA0NRB0׎6v`;;Q{b.:'ziFw=?^SWrr{rP\ s|5Fj̹xeB5_]\+/Y [X/7q*hkOaŠ~Lvނ0#sDukO[U]'>=w|.xN4h D$e"bb`کL~D9e5FB#S^<"c0cJt{L91wH3!pܹBI{.qIJurl?`QHM钱)T]!p,]O?VOҀ +p[ 3^з؆ZܼI4]b" J6ƆAi2Ros^,ʹn6[V逶aZlG4ƄWS&Wncލz,1 (z׹$5Ţs?-pzq.#S2C=麭0"jT7~B6jm1U~ ‰tW5{Xtӻi U#랽ņEfs}FU՘NO"-v%IzVqxJ|c%YNQɔ^1ACo*pcS6y>8|/Q%pܣ >K]X}o Op"z 7'&;.A] fr6rZݫ_j(q-ӾEL쵯@jZ.c!ajQ9N',ȠxBݙӘ I u|}iMMN;="> EɝO8ԒcazPLyDK{| 8 s{Xe'H,iqܦK?;"*8N r'2iPS4:!dўzS֣ÆmfNs9qxfFOnJq.չfN,¯mZZ@4aa)Y2&>xmɬ8T]Y z;yi.$³c'bEx'S4ņ^*錠us9띷S*58B,#}fH:Զ + qAB#΁yhG#Y-_t&sLiLW)KB CNmRDCa\[Sz3=!(;/\>ɁIDGxsCةWЎٽ7睰ز[#5k"z1#!fx *W߉ 鹷P Y;[fjLA + 4ʞt`7P30̅OjӮjDآ]h?(O2ڥ:.WRH?al5e"(pѰ㦤)DWL? ?'b/AF_X8TPi`b ̓R& pxz,)y˞ًGoDөG?SWqs`} zO+q'||AحMc#aP|p)M/YDȷHq.N$DO(o Nv x;QIg箒5+P@@ӅB<jgn eMqlPE:nw=n:Hy J2B#@KtTǁ1T9K |퀒rT 3mMׁR22Qlad,Ji'{?T PMg]QzF v $HV;0@ޜ@z8 w2M6bNKquіY:qv]颌,C|݁0޾"tk]8uIOV-_ oG׵1(B[**L?pwi^'pK/_]6#uJ<ǐ4G)-{"/z.Ǡd)C'i̫ZJkumFQ4gA3CÕ@pSaKkDP8~]tZ ,#E4&R?̦YG[ VibldJg(AJR:Cb>EC;~=SNWLSWIE,i/ik*\vGa߄UP'$)5Wq_-]2 V }]]IW} ;O9`9qZd9d:3[e72 adLO+[ǒj_x ΂ IjQO=.۠F`ŚjB1 غHx xrq`y-x&J{*5XȕDƟ6ZBu2ݠ%Q/CҪ/W/Wh6لCᶇ1f{Σd.tl&|c>K( h|Ax "x.ttƣwEhz?j%);`)7f'M߻B|d*=L,E{J&$+tُ/U$3iE!%SyWN\)n7\կC{sb䴏9*3eYMyhNEBPU jZ@?D>*'ɡdwKh~CFi CCHtnOb0g>G ])jm$E h+3 RO*EjV`~z\DJ.d<{?&2=.8j4? ln>pqJi>rpׁ.hxC z&j%D1Ne%KHe/pWrxv7g;zDTD,<׀U$0QA\ K+Mk/Z:e1\t%o[0 4ؾ~G|o5@4bz?'$ql^\:[~ @rn]횬]rzfBVY1qNo[R&X{MaN!Z2tt_ܲػ?DMspvc\q~Xo_L?NDC}a,Sc3K(p [M#u(IU^Tx'ڵFր$0Qc{QpV~Et MC0D]6!4Mkf*sf{~JIrd xFwt4!!SпXr(A< Mj'{kAzA BNV)zV(O'm!T;֞Y*r1t@YE=,zrzgo\gJ4+T ҁ B5̱L =6  o?%ZNp| Ax)f"BoA$7l&82[acc@BVx-ezr^dA-0f~ &eG,U2$ =(u|>$Ta \mR%Jx=GN2tu!LFT^g'̟& AJRf\@)li;bBG'J\w دNoeϜ`!̡y5;.;/_؏IQ.?Yroէ|Nܱ'p]5ov#9qMp0%oݓĩdGϡ7MZ,ˁxuDelR]rPEP=;"_h)#=氃 riSB+`qB$n壉ECïc;3. "VFDeׂqk8Y{'Zznyth$$8 Z<dsOԵV-n&|Q R E*>7uMuªjn.E\VHgFʲ#dt}?R?_L`_Awr?῞gSpŬ6ܯ)) fI]xOdg:N_**u QK/@}Q6%x: Y&=Gzt[0nI90O(4n]3$>AqaRxB}hG,4<'fIl%c7t<ۛSq#?I|K`~v8g0ӱ=RVXTD`}E ʫ 1qU.+l52 ώ=Y@i܋GAL'$8^nIh!OU{|RF~, gˍh0wMw'fo5 &p;n7 /2X3H9ͫ- u]MY87P፰lm" ,s X *`c{p]^ЬGt!;@j\e8kfvkkDZ˗zF3!ʧ[]wk3 O20}Lb`NNFN99pSL=d>nW?wdߒF!%iO2=5| bƋ-̩1I/G Yk?ƛ趲7]@:d*H2uw/ : ]mF|s`R{A;ͦyB%+* 5Z#_e~(;P#}y0 u;L"!-yL቏tMZC7JRj_93PbѢnھp+o}fD!Ғ!CSеIN V< %֝{ŷ x==v"~\JdYQLr#PYgH|-wqZAsF!kFwf*6a/YC%'➺鞔-T `=[Q;a;1uncjnFxlykaO[=\ KOiXL6#1:\>%I>:7뙢")vnvݲ^ { S`.b 1]ή'Iʦ@~2@m?|Պ0E8˖C'Y\ir'EaRg%PBChn{ӴKzkE>ER 愥W (o {.Z{Cش[& +P 3)2: 0H3}Uyȟlx6HIK1g'CBY~ipbP ˲j TmļݾHDm1{HSlP[FASM4 ZZ4>a,7l;b| "< Bh11};Y{̳'>Vߪϵ mhofG*0>ˍKƖ/d#99W({!``';IbuSr SGE}`@hkv*w$UA)-b1R>JLTNbE HV4hpߧ/R3Y}TvTT^N -Vv徫ޭ`OW?QPe:GK.$nmS1g4R4Y1~oBORlzx怋:zђ2rQ56 /#Xϛ|nXv*NI梨DKl֞ō9PJ۳=?R$eYɜԁĽ")%3}#řو7JV z%4lxq30'2_JJ*sz BdѸJf)4L2Ғ:aʎ?}dRuФz0Y_HH8רzwf?a zlM\_/Xe5`V1ZH!(5͓x[@Pz Oд62Tx ⅃^#T]ic&aqW;ZG7氒Is]:7`rIDTOR r\gll,- 3:O<>6"jI1h-Yĺ{:2ԁ6ҾUKTh?y7?iu*d:KE rbq}1X Җ+vR@/a^)hVkV\7 C _+Hӈrťs%(5HH|{>t'n '?e3~XdU-y&(6/3gn.x 5aA|D⑽nYf$̢;h-YH-xvh)ITr5 *״%c},Z(뀱-@? 壠ZJ/I,|= ZrkzL_9"O3.) 8?$vdž@9'3m߁x"c+RV4@N&PoǕsW 2T焈1Q ?eiD֩W+(+Gu"H2ـ5 rax"f6uM#6e(Hc2h [,ȝ|}mfn'=`hݸyiW/aI#ǜbaֲY9i3թF` ֺ֋]V]E O>*l_e4n2uy3`Yƨ;1HpU-!\"]N 7ϑɋ6Xh/b#)2+4 T!,\y? D7MS wcm"֩]>7Y U. #M0&S ~p63t+3" t^!k=EY:X0i;[De}1 )j{)]W{1[22J,Lm']@@ eV'Z^ "^f%:zL-yY[wR4;46EB*@@v_ʠlD<,ۦ=p[LgkJ)b\vnL9´O}Wܨ*%@/w? -U)%dJ$:x8\+c`-J "8ݙ'#Z~3P7wS, >ssui/"\_d'iN_\=MC@=kuFv7>8${ޢ$?KnJf]˲JZ79uUWy!kcLxq7fe+? ~ՈFjÁiFo6c;"MSkyKj>UWK @'ݹ|DL.6ϖ ߌ΅3§pcO!€npїd>Ω+"7W}\S; +?ٟ;wAώkWl?$Z~:/ XyXGKq"$^sYuqQ=H/*HF9tE$Ym\$6\' ӳN.vaNLqHjmz(R99HE|EB4i+)(2$O&TP)V~rZkxb鐦 f>\Q9 [W??Ŝ3վ}>X>gL#47)@Oyg%E ps?f|*\ckju_#^8a*C%>smΞ9~}.]@,F*>gxX)W'tDJuCo5Nyx|K*4XaI黣F0InX78( @la3!(U^z9y>)± {pp++Av2g;F88SZP?;~n 6A7+]*u4hAI7BuW\_-ڋ\Wm !l E#S'&nsp ՘N1ނѰ29,)u˜3:ߧFX[=,Տk itBZgk*9!>4Sb5 "`OODXyHŹR5 ^fdfO2$/5b*e<V_L_QX#6zΖ(&HNA@@=]ȝir|Q=J kDJnꍧprdOτB6)W7"s^Chϰ{ `'}H@☂&:iC͕طZ2$ 8^f%›Djf 4̫K ]l ƔiiE"Ǘ 9UUr ',NR)àVavP1[N_Eu&s 'F^ k~,J#(CBw ,ല0|<# lcu}}ăDro{X_[֍3$`r }_Vy>_mS>9Dm[N$Fi;*T'!I.AHt\DQJL ܎[l0@ #H'*Sb j&QCEɋ@K3KܽdF?!%^1C\ҟǙX?X&&$ H)iq3HD}Ln@i_]UJT.כj#B̾,J`g?SEIUW!x/%oL:znAxwu7_KnjTZGՉng^҃VS/fRhk&_0$x*%B7ae hiÐ s)_1KnhLѶkF|s`_%PD~ dʼn;~J.gB>"X>K*& CzL\hD{Jb hkQ6&8O.fJ6'$~1c]YJ/GCzfћ, uaXtBhO}’+ߊ\#@6v4isxá\^@n :-(ӟp.̦9E=O> sv ٘kuVʀL(5zKq%]֣q|%uEOi7/9/kAl+n4cbwtpw Yjq˾yk<ÄwCMFC+ ftIBK9 &xIi uEO7 %d৖TiJ)`/$ K*D rb!d|R "2p谻Fmt4(\Vn=$,-!7Sx\w[t7f9*$-U.}>Fd3&0-ljiɘ\B8xj:w| &CUSD%jNT(PILGzG%FJ\FL*CNnԙy2P ֏Z2<>y;Em-hS[zSZ=@vo prGUg:IPj:.1Lʺs_pF*%e< pr{;jՏ dMP\فq&Tp"fu (y@,}̫6vє\qL~D>lp9&O ]ڂj djW2QS5hYFR숼+;zZ> {Nڙ^|A!9UP8>=qQKJMsBJ@U5O>?pTODk(] LK \+ݽ͕gR JPKh 16E7s|A! o wfW C4UJ!r$, Dmp;R?)o( nhpYMg(j~rbbldˡQ9ʂz K{.=e U ʌ@p@"2ǿukz|XkGś8P NϜTq5Vn:3?<[n]/w]mT_nif%e_%pw6H+Rx]^.kC`/,"%4,2/s.yJ9>% fQlJԛVbgm!菐ݴOc0K+qF 4;NMx9Q.sb6m(ysKۮFG o2`wk)fGȧ3 [%L~V|ԷX0P$O3"3ͪ,_L8H_iFC܃YT>"N _ ȁz& ە&x-9>2U'˘wU,쀂Uv][oƒx97Av_.r/ gP4ISkl!P?0X2'@:P.{)`~T%es]n_|EAsJADd1Q4Z$"ttNX:uW] xG [ku #qR;`-m'&|]J>1 ~c.)UT[[5RzLCn߄;"'q! ǿ !sZ(4ZܶI+Rpu_*7QK( *;𙿳AHMGb wf›ORHTm֣:'ߖ_tvA`"ri,z7* a@޴d+"?R!10qS|N]:Xg Ty {5/W +eIN7֟5کG8';F,Kiq>9Ytu|Br'2h9[w쨝7KeJy]W$ciMRm(q`=7`vZk`9YJGoO,H([dzi#6 IPLe8bN ;">S,>Ҕuo,[T!IAǎxN&gM!*RKy}c[#Qnzt .< a_~mqްȆSXp˝ʴWzZ]z6xadBrA RjWZ~j1L4m@S6$[(w@eڥ4sm|hZ"y!fjU54.aNI::wvH*Js݈u0kYo{79 5]ΡcQhsrxWh^VKufP?ST&{F3nH,괊.T;dWW1™)ݍT,S{ȹ.ik1tSƕpVsQ<#e?Όp}xJ\3V3@SջN_iBㆸܘsW 2Ts>bmp" Q:#ܬ $uk _]UGrs`č(Q,1q*pT[4zk3[ZYW n>k76{ANCK>P=QfzCpkz@^ j@ m\nP7O[nyR(}l, FNSyP_DR "@YJf 9A#.!2NL"W6qrL׺S>p'xL2 10/{cIl bBkNv\0(F E  r6=ːDQf|F%f>?1\]#GWEeZM #M;ki?~ܻB:npYf~~/8܋/2!Y®{ކw'?Q Rx0#\Me]Zk" Nv>ZMM+&^dVQ[9/nRF ZCMT&y_&n<6tN@%߆}284 6j҅*]2,l~FQ B#R  \U6 'M1[$(l{"`P0_] "p$>cfLt oʎWgFL/TECXG-ӡ12]'>x3GjvI='$eJ<5I1(|1=L5v֖5ZH]ʺzX6;Lhʃ\5ZP<4›3}Qw:@x?3N*5"DHB0bqX(|{xb׀,Ֆ]~"fWvlH؆bZYbWHb#&@Eg B&J'h] 6;7)%qhh-')a)B` 9+?B3h,gd[yVQY, }| Y#^q4;Q)'MgU^=RSwKG8RJ%;Q<F}(* bcH!ǑB* ?ߟfm&0P $9YL"؀EXy gs[e[IG"EjxBF7AfƦ VH_MK d=GW"25*#؄F{{N ַ[Y; &N+NDMgf7\O8U76w+kPkޫ?=k޻xK%0reR܌vܦT1B :H&ia^qXAo~'XҶ $Ũ`α,G+C܏rs`PS 6QN^5xr2*Zo?2pٞ NqoD;ނO= ;Ƒ8o!ZW b $ 1UD9+!j\20T*!,sVw_TQ-i wᨑ6 b@(~u2ǡL+FϠӀJqC U?wBA0#(nau:cW`<9.rAkggMʨaI׊RLaMaAb]q Fy6԰s}py} / f{FxyOj5 wYO`xH`ҿUYٸ9sdz֞-l?:;[TZXw[axRoL7rR-pn(-J;Q7lwpC N󅡥rm(T)\d=*;6U1 @0P[lDف=mXPެh<"p LTRVmޜ߼>xx"ï'M)*S$)b޴{a܃Y֤E}C@7,ц ,fXƤ5hmgIȎ[m=c4k>,UjhsuiKic;Hsd1Hj.11&|%iQG>PY6fP I! !]jk@132R)v}_9@1_|>,a+8/4Op%T7J_msjª[4 ;W&[1bwqӕ.;2auDWú!f=aҩ?!;H׃h<Δ$&&^⼵0H\Pb]xyRfփ+87Ւd=(ݗTap >Nj$ 9zZ]OcޤߺCo~QxU]6=jT¦0JPZ0,s^fj$tuF%?kIGp_ PxH@sMY&Hf$B*#U aŽ4UՖ@f=ZFy>ܹsg'K9Ig Xd$6с]/_KOYOnbnToŲ *,?}jѨ9`gpG8ӉAj9(Fe8WVJa\cKқZ@N1f 4_cٿ)Xā\W9gTmǝdCKk#䘗~2:Q-.4=cHD@܄m,b&mWd[X9Ϝc9KF&)<}E=Kjr\LZ4-[c?ͫBwHPNzbuQez{?ElKTxw %?O E=ҤloxYCەzH:$2TdwlZ#xM&ލ *Fk{ۦ0h aDaSi\_6>hNȰFrrAW-[rrXKWFZa?WxPy{OD5A(Uǎ.n"hBrf(c#0wJ0l6 {NE!ȶ+go[GOv?W#RV3^Byp嵿?T@ՎaKfIbsOHr9.1$n&M.5aMХ²̣}"Ɨ}*aFNX3A۹,Zͼ~b?z]?D0iUU#yL eE) 2,^`(Cg(]Iȯ5T/{{JdA2Fcr|ZDh*ĒqO`F1tMk6%4dF_g}cs0s?!3ZT?睘̙#v'Zx\ĮV`.޻a[u&ŘGs .3'JqnNaX`~H^2 gU"0~w,„/Ct6g{Z.d" YoFZB3Ty XXάfxj9GER&3<ȫRˍ?sZD>)KQOFބS/T!8zP@RPiL~6Dw8vԎu$8Bֈ{eƼ*H~[Պ|u^d cs 8n;q[LLD=1!ѮxofX+aPu'pyLң},L՞xUOgQl.U1RRHp:xVJZGwۙmLa{P9+[Oy4$^M]n/]r.wO˱.t1I}W̻mMTnfr}xc(Mz6'_ lp03L8I:\. 8D{j\2 \-yÕ;ede731FxBRGJcݳ{q􄅏ZuP>wGM 㭗X#>uڙwL(E9l&-P֦f)oRt]¥T:L5:hªqaJ[T qnqJ[:W={ c]CD0si-0d̔?Pm"kf 별~ _',Xsa/h6cїG!J+~v-`YiV8zs^Ys9ŕJ6*-zCV2LvM&W&Ky&|=gq^y&@-)Uof~9KD]0 <+A=q'IS#­'d{]3Y} A<)B2ݪIyR[8݁f;J0ͩȴÏv4OKD {"Lȵ=}P2Gfs}\r^)VхBnh$aM[,!Ȓ@SJjjVly:gSe6^-?!h _%fnBa=芽~ {w̌hz:Ɣћg}=O Μ} T q7FKOb341jv /ILձdf⟱BlGLkP (hPV1* k"8DJ^>t9 x BM8t HTGoSj>9%94FN,M6)ְ"ZNx5SIǰ~՚̂|O"pqRmcT\(gHiOAot ;;?e;`JZkUKwzK8MW|j]#wCY =| Pa21Tz6M8q2/zL!Ul;;YGw`F FO ǹr!Ӈa=1$i'*_u«/>ҹS6&+xsP,|3;)H;IW֙H-@XeM/꧊G'`&֥,^Ȓt=l23#tѵ~B7eVH2c,8MC6nE>S3gi2r2D&.Vc)|ؚN|-:mba-t1?]_n:o&$ 0-"zoGaXZѵhBS,lkDL{ l%ik'Q d9 dåHƂ?51ARk{A9\1mohG;몔xlWBtm_QC*]o)2Ċޘȶe-.fst,*RwaEQ~] }wsp5dW|F"|gpKLWD| { 3+3d X8S Ĕ)c(^~E·FtW7q]qӭ%ϮWq&!'X|y f'@B{Uk+~[TdLfXhvi&,[٥'V?h,c੅[#I)Z lbOꌥKGKu`-#(3tS2&XjgɻZiO+S`ɠ臥Yx2RF\Dю|7 0*!+FEvzJ~|Ty5xEIb~D||4$jWt{Z A# wT'rk4"TbJo-w,;ƣNZ6Y׻)Ӊ_UG3NbRV\*eҐ{fxƆ붩l_h5y+b.5 '%B5q݋wB'QXO<.t`*'<.,A`np%I2 H/QRgDthcU?_V KE4yfT&p8ưm1掐qu2QHgiጾV֯S`n1Xh?t"2a=˥X]ɗʳRcHQu)un_q0ᵀ;FPiE*(H?E i 4`OYyɺj }e?LDG2{UWa46VNrq\01(C5uh zb6jd, SaJui> X5an+ UFʣQo[2l[w푿̙P-b(Vx7ũZTT=^Ka H [Yb[a} -|)IB EOq{C5\anf(TR㞀[s@\"M~kibɅr'@҅&HC!/ 0#PLG~ >%2a07~e]COB|o>%>6sIHF>x1ɔ`۠qoFk{]* 5Df[M+#UZ ڒN mՕ>Y]Cq4zbmki_ȝ,!UB<[TaIkv l{h_JKmߵM c"ND6J zĸ~&uH^Ed{i1ЫPܦ}F(DGWv57]*G8T&/'$9^Oӊ/kt[vAZ]P>P>J<=dӾdc*T_\+J,Xƌ. Qk%J䱛(#n%tyXU bcrSA:dOPtzUOon-}B>EADi|/zI dNs3f^-sda%-$(tyE J-E3\8^j sDyG2':άB1 ֲ3blgWe/Vde,)1xhlvjZO@U2k@^]/.Dkb[o+aS . LRT:0{'8,Q0"ο3a`1'GzHPx wT{g6 7Gh-1Y~DJg4˵Ѿd8LE \ba?&5qT4@yWg鰻ĉI$?o`|Mp@0?>;L#5[@PP_-3Gxt w6TZf-D܄OxZn r-'dghQUH ׭AJ_Ļ S+D0 *Τxf9aɺ~^i! b7/ij++9;x(eW,TGv[6>6g4(k r،ESMLC=DHkCټbLcx(eް7b](4rd#Zᅱ xkiZ#/W2ۅKKZe&y*VYȟu†a<ގ*!_AΙ L6Z|js@8|`J>1X <W(jmŖd=\xdgY3/yMz (5LL[K6G3,i|Bpe 'p@9!Ddq:7ֵ 4FS:}H>O 3{p-|OZ<21!b.;p2u/]ټԵnE!LAp ێ*{FpK Ғ\P=n!0WZ2/!%'r~YNtQn})E1i}R>EOr*6/A07#&kZf̂Dzo5uenI׿AEÀfw ZIeqGVn AyplT!C? 2?Di*O^:x6j{UΠ,?^֭S[rR|NwMٟAyYXP@LZ>!!s_>|@AΉ `QlƱ_Z..ϝ,Sp>VJĈ6':S]2" , )\c{E( yD.@+BR{f7i@ȃkTY`/P!80*LaKp˚SCqHBټY~&:M3@LJ8 8zl[N+4Ƹ!u0Fkl^訝NֵWP^Je_dgsӝ.xʹw!q)([2rHWF}[V"l7\y㗠GO*LUT~{jy~ՠ"3p*vM9^]ߚ]WwǞ_+cm.jܯhhPPVn ?4O)`p򣷃j5ՙ`s 8k 7_SA±ﳽjOSll_{3\ŋeWNB8aRPZB9?:q:_n]y8 EKD"ήt0YOd88cuj1y%V=+w 4fl|P}'kTȄ_]qhaX6`]`y/lJ]8@}6caPdѤ r_dɥѨE(EJ(`U"9Y¡cJV<c ~; 2EkUX,$I Ǔ GK ˴䴀vFl !]Xj. ͕*_9FxTqDHh$Zo"UF6[uEk%Y;,~duAo 9EzDX9b:u=bK?"~./Lw+&vX5a +lO9lKI!d.o:Gr^J@Z'OҴb81R9qmr-x`X@wyAVеمUu4mdVyK 4P#+n;{{Ab=j`%4,Lj=} @`Nl" f$Ѥ ŚOJ_F -JĚKۮt5"䭝c"HsetqF.@Yڝ#\r)]}PWQ4Be,X# H"rBpTU P6CKS0s}=p7,k6W=X,"-=$7=Q0saeg\Ɓ:B mE$HS>0!1bgA}5X $W@׷T%t pH< 8( V\OA#l9#XC Xt^]֨ܺjdC^g#vJ4$ -}1Nwx[AmXW5^\v Ok$_tS\/ + ,.eu V!lR."@$Ce).д4id/meo~ipu]q#yL׃hh),>b5kwWppHD$H]vbV2IW]ލ.P*Ɇ"rК`(aRQ-& q (~K3ϣ!P&W{:vJ۽lUyUdl9EchΠv`0je"*u+ɸpxYKHL4c=%qYh&Lo9h4[ukHj5FKBhcf9}?T% VkJ5FM|bǵv2ڍ&dw+b0.[ `Xf  \6F `49]D;KK}0Z Ox[1^*sN'#nf"rwJu5㕓b惢)ns>8/Ƣ]$f0x?묡!xRJH͹e |0[=Zh |#e`ox񿘟Ywxt6*&^΁MͬMk<"d/3tI4&)؊U;+ rj_%QsLEEPV$>%cۣ%po *7sޟu]oॶbS/YM Rз.6o=HGLvN Ȣ<~%dSF{|Œ~mx4'MeUЗg1c~x= E|%U2f5 Q DR3T%w!̞IY"vi$^Ln݄OH.ē 9:t7!i8.WS@ʫ@"'KTv ݱߤx`Pb S~K-Oe32Q.%a2_{J`գ7Hހyu")e_vfme S6w)``ҁna4ufE?;2.F$~4~XaJL9%Mx<:K X@cpy^ x6GhT*)㩿M Xu4/ڂTFs| xg|.c_4,PqMt ":g.8IS<(GńZ dу1sSl*aͯ QfAݾ~<0ygZF3*iIoctv)E)mKBgLzvq:KQI!$Ղ͝M3 _ ͐i#eh-ݍl0WE)>FHr8zsWh;HV8oޯkRp̺9|Z߽<)`B>ck29mE 5ĭq `9CZ{95ei&xy!0#muS`-W`ktǙx=[Qe* |(*A0LfN]~.8B-~HLob7gVC p.)QRxC2BM`oY1]JsP;=9吸 X2 ]mMe,+]~3k㏫wn?<.ļP.|b=b *5S9IBvM {^tuw[]CSqejZܝゕfWר:֨W WjɷҨ.+wg3_g4[u'BS؆<-~ MQﲲ0<&q;3a$bO/nd|9!K3)lrNYB|ږrJOٟɏc [{5~&n 𮵋pwPU/kpŗ(ZSo1$m[Q&xX'&QQ̵D(1yf.&ɞk¢PùWC t$5Ѫxݹu>o쐧ҰCۥW郜%BGSI}/m L%M) #Z e̙5^"+l$ٵdiEV%! 1Iߚ6}1>j< B2ْټ6a+LW1d,޺ǁm$`kz ~lEb* _4f3nPNJK2}-vh5JO2"@ĮJ *>tZ1-/%X)2~&DP-!l.Y~q_*5HۇЙ{Bٶp /r=k@'_Evyt4nHڤK%b|c~=Kǯ@c4cH\.:eJK=ftk[Jx(ebM[,Rr+MLSX؝e|&mOT.=:H P4w4үku)['nN2tAɅH]j9ks*B) Xm̆<0 `i9It[EdK{QF GieRjMQ31EΖeL"ꪣQqfoPyg$P㳮?"8C{(VljGz ա>M-Sׂ6ǡD.L$&n>< {:z˘#~esPOL=c`K M_ng|AՈ6z&pY&AL{c#HZY7CӐ EBBxc-NK&CeCRx;%x3cQMf ¶Tf|y{/7v1ƌ@U^ԍd֘WGIuO-Zved-gsGĐ-U6p 1xҝz\[rb0XPѼ؂걼TkGl5_F|N 6X~&Ese Ap&!k$Y+Gh #+scu+/ĂN1 >o}pFld/"VtGZq߻)32ӵ:~n:}W_d(b(M:OkWp?ާzR^N¯WO^uV>#2dGG`,BA.]L6 SR!| A8vU⅂MCǡwD{Pru&,Qdvv.UmOEe%'~L.#px PϘ川XY>1Zp4BXοyZ.u?1S׾|( \DW] i5 噢Z~K8"tU&WחikZ蟥PH;*":ɩJ}S?`ނ*~=[_ gdZϱ:2F3`{)d:9b)!) IN0}!]b_@ 7:ϔUzl@3U]~>ܽ~i1%ԃٖz*:Yv6ۛ22+1YĠ'SԓB *^s#M]Z}ڭp{4ꩤ0:T0L؂,d,7 fq;C Ꟃe-q\hzC7pص "Zu'Wx=7mǐz 8uA:D\&!DjXi SW1X ΏT[⾥d&tn5M҂1L v t`͌6%gKEPv%򈅝J~âZ6WԺkƜ[0-c.(02N+w:,):< "hkFK0*CW[ fj\ڷB={hun",ڔʀ۞CT8E* 0i]pJ-D/lc2n0Ə |Qf=\P ZUђ3ш)ekUTv eòW8~l;P`,EK^"ni/0fUmv N[158lS]}8aƒ}'}Ǖ>NoOd"w3,(G 0qҪo8r-YZv]t@2IeM[:>V)b`T5s&AV844 ҾrZIlrҵ3\5y|.@ ͠›o>bˏ\HNZZ˟dņVU%)9XOL *n~\(=L-MR!+!>'/QW0OR%e׳ @cEfex z?}a$_ɫ]6\-:Mkhb1Wܸ,w1i!bu啦ѻÎgy@%ei 0lӻ3GG|AKUK#?/H&w^D*b:vhzY\<Ѝnvw: nE^vW gw2UZHt=je:;dَiW~64{)}}_1;BRvZwPC (6Stqk,HE-_nJk ߴf1J3LLػPBNrv~; 2ڛ] o7ٺVDW}@ -p^z1y!Ԡ2Y )pշA*C$*Ԅ*wGV 6A[w-w*2dR 27;g8"Ka'd Z6v߉5Gh-YVWC3Q. ):SKT\<-rөJ %㫒u/.q^^Ro sbg\,Oi`zAG {!/IFC(6y$#..6hFCY8A?gFbigMZ5+.T$:_5iVT׃P1ꕖs}(gbn_~+xcMY"!S?V6 Ẃ_]ĨWm+*.Xh91 #,J "'քCZ8KRk}Fb]3s-0C)0RBʑ}N>LیÑt&k'ҨV>&z橶a2F 5'?*8 GA32$_>l2IjO|}ggɝGossRM .}ːVl0cmNpb.uk-N(߅|tG7jnSZ |UH nJ[DmCLC.kt&kbYdzL"8,hOH O7`-B0M\<|a ߄G(U"x$)D"GƅERAOݔLMJ.C. QAY]an1hB)$ܴ3YHG%ސIcJ7c>Z"?BCr֪.dӀ-#qv@&cF9eC$ }7w#%se~f=W,U`\IrL+,u3ʓ?Fa͌4s:0 T/:=vq2]2vZeN0vĞ[|܎j3těM^ 8v8;eHEܿ^^[sP3; ~L$V\NwT>ix};or0_TwbKD/g;11šAv8՟#jN"AkHaSrW0Cj&ljv͉8 ֙ d^ ⥟x hfU-$pf19Q QE{ 17 RJ䏞V mCDB:9$-+ͧr R8!#OFpk4W4`Q8?N~c=q˙>zI*eQ--ȱSDг:'5͊Wur$8Qh&maWdD69xN.ZWeU Q/ȓ3 /+/ v=9M ju;"f~m7$v+^$%G9\S}VABFHAqV࡯";SrhJ%bӌ+6ϩ TN"# RFщ5|ۿ"DǸvŸa ٵôe~|j:Y=U*Ltc1:z>Yۛ}_.E(E{cկ=ϗ䬚]2mj eʟ~[#r>aWq5#۟;gIKßw.Tey9:%d17K -Y= e%ўK 226_QIPC!KXtѷxa@=J֟I+o˓›IHÃkj,$Zec`9h_~- F>q]wcQs|ch  hL_jSxFIܞ^s>P>~Ja_#EFfcF0Ui=YhkG˸W6 i]bUif|Gӄv>iAdޛ%!¥03 6KcqNn^)`؄pe;GK{]2m7j `!xӏCȹ忺=r ôẗTeի1ǭ/HQ(6TY}hjqY>%?ua`)Qh YϴUbiy r'.KS3XY4 ȓf6Φ1pUDᤃɝeO .0tfn M'Lj>>}R `_OMr9]܍#1RǬzb 5b)%US$0S*]l#P=٭XJoo/U՞2C_F tPռvY$rYo/[sHtݽ )幵\֞0[F @>1]tkf&S>ӗ@US-.}ӑ+ ^M/4簦%6N+lS0;Mc$fH&֓2 U<*^C^TfH^y4U6HL^ѡ% 888  Ɠ;$["Z4αO^e߳U:;ׯR?{G1H!a s 16MZКp5@[JD˥}w-хG|`:Q=vg=qrhWWjB;k`/~ Jx~XC沒S$썹:ɹߗ_'p{a Cs}8E߱@jMml8-hKu!Me`/ \:BqJ*{^8].W[Y<$5~e2x@ϨM\؄|S8o?\B &MCp;`X PH$f$% UuD@Ȣ, |WnnqJO/?V]0]ulQ#{˗@±gFnvz*gt;rN|Gm^DOyw8ͰyeY2\[0rBlXXS51(4; c>I~p1?&QuE|u탢C G^񍱅 N(39b[(IŢK.u8Y#c93 Z O`s "g"INs10@驱=3W)fu.]S4./M lP*HQYuTﮕBIC҆f,\ifƖ zܪ;sM]ZȖ=!DG=1ą׉}^+3րl}dUSק $/H|R)ܿ4O(:ɧpD3$Oc0Ҵu^/OR,xYV;{?mMwDU v82(&^ 1*|PepR:[WVlIF3<7Zc$঑ho>&1EUgqb}RgЖÄp8dlMlʭ , 9 ԧGl/.#*)%,P<~n Z^Ů.gIFw݃ ~ٺ\)(vy &:t/R۠|&[yo?Wp$GPK&]8nd 7~ι}`I@o ՗)d$Uh9q*-q|OyxS;ӏ BIXo+M5/X!;5(^XIS l? ƿ%iZ3b~l7D-v$ /KΠ=d!ȗHhZRˏ&&RG}D'12é@*)c}QKI: * xk7gl[K0o"t?N蟶K,=eLL? 0䖥ң~q ='d(*h]=erFU@%⫂@id"Jr tҖK@ [~tqxsP($r@l-r hc66D9 &U_TN2fO}Uڼ1LRMKCn17.a$it@1e-^rҭQY?e)Vj pgm}bݪZ7`8cHKIoz:¸sݹ 3.昩OFs*A,bцzxNs$EAdev^^/mIl"saEU| Xٶ[p9O-'²C̢ޣFa1>,ƒó(oe7ʼn 7$ģS@aa*Zݜ`j0of 3d`9C є~ A[9_B>YDS/ؒc݋<r)aS-g2  ZaV|,3PkJ~$O3]eAܣjy1iwW'ddRV&Eah|;59nt"*$ҝBVԄ1m.R'ȚEo*62sA}&_a;td %02 Wf |@{PT|Bd\un6*"y2ة7+|]̉)Z:eюjO^愱)x0VeiWZ@Z2 /C \}1y˰[!t䳚z-&L"g1Cd|Lax.qGɁGpD3+ @D/Ac -Fʧ0Ժ jX[RίVRĮod?00E~5,y@JA7kRC*KߦHt-^Bln6*?[Пcl=*lMqb(j`AF~C~g \A"H<彯3"9K"z\*`ysեHָRb9yτIX۶Dj*M6V71ڲ6eƌf>v`<)q]l~A!]:[o?>({VယӴ s T]65,jmB1Qu֢*sKu4@ަݥkr"֨w-C9GmƜɹlc:R&AX6&7]%o^`\ -PGiWc4Kp8fH[Vjx6"U:N4 a _tGY=){]p-%b(n*ΊqZL͔SD쯩1IZ6b.Uٿ{"E35B40rӁb]pmXUvydnkoo0V{E"퀓QK:亂v`]$7IkT pIN"|U?\1SqO4APaab,bVvކrQya^tZ*'?ruHY"ypctlLG^{yTd3aH9-/ wG%sSs'R.ZH(pM0 B~ς` !Q_y.F΃e {DrYoy/8XȄxܫRH@[qAm FP͚9hjh(1{Py\>w@;//Os/c/1jr Q@F1YN1W<e|0V"$+x~eLa@~j낯OKF#C\$ч&AxG) uJctq3;H%M6n5eFE.L2iQ`Q"$ 2v%h?3̽dp+JᑃaGg[RDflRiG$Eխa䡽|̦t˪',4$c^hށqӰB^䃟X4m.C[R6w|KV@]8>jfRRk>Ѡ1ua{(:4~]Tv)؅:ǜZ1sI}9?3O3bum mòԏ:3Ӭ fs ݧuJr|`T{,4rH(b\ 6H'4V6[J!cCcn Yo7zA ;y Zr,vޅ/y\]?+z1Ѧ6|c -DLdZ:POZ-ºHH51 &qdΫ*<ή19*f&qs;9Eudʬ#[Ưo5-P$pxӐ-= ! pt]箥TLGL;8ь"VzDҲJnpdkqɂXI&9K,&[,C S,& 1&ۂքy '>P>yɺ lALSl/n6P*;\P-op]PK%]w &M> Ŕb2IB]tBˬ (i†g/1EeuPIf=8``U{s$c>?4}^<>(i$>۩XŋxscV}i m_ǣ-4N^|-[/-p7eeDX*ޱ'LE|YqjUWۘ)2J^G=e.cvāiX5x;v /)J v4Km+'*:w7'5|!ᓞF sQO2.L>&Py/Sˏxmދ3R1r8b.\Ht98"Eq\q~JgUT3@ ,Dh/YRHϞ6~vo_D!+bU+5r< 3q#NKMkpݢՒ͚QɍVjQCþ䛨[e2tHuDsxZ0:uʞy'BAc IP =Wn8BKDa`۾:g δts7-(dHu2bZ(]^tABH! ňqb1Z5[mL+3EH"q1T)|dm9..ޗt KμfT"e!!AS18+?-;О엙8wTEdw=Dڐucn+h7^ E?jwЩOr #FfSgƹg~3 XݓS\Փ1E+&" }EOiFMoڀ ~hfPYVBP TުdPz6$j_7e vb9BE[|nK+"d_KUbEhd ŏ;%IC0u")//+ppbQO"cx7r725I?*=4 uiEJ!`)]xo]̦=0/v™5~+LW_[mf-kUCL.Lŝѕ*-#*Ut!Vh Hw}W2w Hm$(B^uMc{iȫ-,1ȵwk ;4&IB(W[WDJ Xh=,&WWBTԋ=Ӯ7 ۲ Mgtxtʶ'!Uwu4t `\Al{`ӫ 6{dH[XO[o?jd,',U ^ԣ)qv%nQu׼8ѩf;m2`?oLəSͦ a>e'\4gFֻ6 r43a<-|Gq\ZT%rZMnpTVyɹU~q<1+v7 :ˎv>W='-A:<0Y_=fUrIG$J,Y>}yowrIh+b1q dN`[w Zi3&F&e@K5wiGf.ZV\f"ێj_AErOmu="ܶ,jkX.!#Ujk8'`INҷWƹlG$mk~0◬{M)3E|A1Ts3J*IE7A Z8RvpP ,0kBƲ^!AQs0zj2$.IKK漺/9'ֻX5Xv8)?ݍq.(mĆ]>]e~ :҇dq27?$ܳ{#|ۨf \nXzn '$L'i'i+uH#'mIv] ;v~Y8_&uf. գWFݭJ/ q.stmtsfIkUF|.p13X@YI߈AJM"/DQ@xeUh?&lؠr tHjhz3z[bqq,Ǧn_\說T1 q\^Z[6٘pu U*eĿ5 I,箌gw@88j*dRbpy/`ck>ew:ٺĽ XNe!Y~EJY?ء*[ 2 mU% v3_~|O^kcPu )4V/3+ k&-%y)P-m<\BAB'[յp U`N{"ڄl0up lZur ֝L¢qiۗ`x<4ɓXa1h|yhOO maX.CKF\2LGaU.T9)UsA%+w/̕K?s{P[nE,)0b~4.cH#9P0%-x2CN``߄3%Xoery ScaU8~(i)ȋ0Of.x^ pt$L |J#ܚtTƪl 0RfAzfzC皻p/_Ɋ!JX^~ o%Ɣ) QL Ti.Kxޭ3`a8۔oDZd Se~gT"B"d л ~$)ӡOdgҚ,>/byzQRf7(cPP@u||y9'tcU'J3!}e( ; LO"Y 7X0 w-teh2Xnp# 󛘃?~KJMAr0V%Plk6u8 O%^FmWG62?9mN?3၎P Ppnæ[I ~yaBet ͫ1}w~six d^S5)RCJDe {-Vl(O&_٠[< fBr=۫ORQk]%T bmsB?q^6 ~@Q,HVIS<>.aS"nK˧~u-_)!#dյF;NXj޿c 4QO!cLje{3p$룛cj ld\r>o}Oѵ>~0BĎ_vyaf( : 4?TKrBJ Ѵ=:֘ JWMŴp 2eq \dSx+R!vy 2Ɵ#!8TSM^Qy s`݄[# ̤ QU796a(#9>FXxLlEr*um3Jk99nJRMVB3cvq~$X'jW)U />3Mn ЄOxmm[JE?.;4lϩ 2Sw!!v"zw- |72S\p U@ux9\veOI0L i;MFO 5֡# 擗m_ILV: -;w֠ڌēVK~?0(R ;= jɓ &1RuƳolm̼\@Z:?00b .$~< JXn$$]rWF_oEz~W{O6})=:H RʀP'5̺\/:1MTR8$YyoZzR{'oZ<hmk8ŏ$2(: V%1-Y>)ԍ}cW "H `v Y& rpN;4xpQ]c"RU4岷tq ;`ˡT+:tp2ubs9w39K'N,|j XQM.cqkc7K+xݒ>%TjQHv_ Ó/6u.C.x^܁SL$Su/ =PSO Cb0-Eaf KΞb_d:.}`FuYk:,R @-TI IW 6fhr-Xcŧ|Bt链3OX.T%pu2q5x?h 4￭- Ѓ/.Yړ#;rrwAjt3[ش-9l-u$)x$:Fiް C߈pWL0L~ư԰JT5rkg)*"#1;eQώ͉Nl/OLpP>PٞIUarDw ρVih'"eeaӳmsnv~w[ NҜ40w?7!48c]fw*$CH^B#EcA mHrGpeޚ ~5dqߝX` axspnl?MO70e\ lt|]rd h%6(QФׅ j1gM\W5'(@# _O8OZ&8">4b5ůDz e҈^$_ &r]&;',!kI0n;EZXҵ[;U ̰X?t?z= ߊّ]Z0P7AojvaDkE~9\F h=A| dq̳D.<sc+%^J&ĥÓ7G"ș!k%dz{ys)nSvTuk>IWDf&ҳ͝~B{]g^UM L% 3.mǘ?QuA%xpyD܎0+{v#e4'h'\3+='2(!p@DOR-TzIjlHنneϨd %a|-i00ڔf@pdx3 rAFLJΊ.ƈ;90A#hBPRd<Nƭja(v.q/yАJ@5Ļ,([{..b` |?]0If7R%|3ʵW7`ˌVmv aJU. OJm~4|CJ } ܀vHpcb+xY.,\!;K;g9u?ft†*edAFX>~ \QU Dh^3r uDl`QƇ ~LZGTq&P}$nN;k+B,nwYt[\Ji{.7&qI mgKvv2;ƊhDg) M9jkAIʀKL3f3[>x>Y߾vdw\B۴WSW/ xH@SO$j{~[nAIQ=mNggb/ RY 䬈Wa2 a}ki9&N=$c1dz @R( w8ءp%aT ?@sӓ\tGvS _8}A`)+ѮCxUwn@G`«-cc>=-M(h)SpM=3j͍^tRb89bVP^fJ$5i>씌)y kY}X Y|P^97*CU8#6`4v #yy[@aYږN*F›Ɲ7 X?^~Fv=ec>K*ot €(tTO]7]t}Ӝ8^meu ~^ձY{rF&bԓhi*~W2&S==h 6K(V1PGƏyԏWvۿw(#ijs!$HE~H" KG~<[+kb2[i̧%bj(IqhHms;;҃m#v%Ro !ĬGx*\hT&R _~͟qAALa_ՋՈC=}ʥ'ݕnxۈ5mb/&`*og5H0rn F# C;|}$>I`仱'TumaEw+3T"UֲqA~Mov`H*_WC$=*Ӗ@ d QI67,'5'3 d<:$jnjiA/Ǫ9i~u톬/]]^͇$ڊjÃ|y'DՈ -ڒ>80lh&iPʑwW UQ=(~bl^ozBT8M~`_tpab*dh">ݼG |G9J\ka s^P"I|gmˍ4Ni/^= uӐJ1S,mtTk4E'tY3-+pΩ=PU|~,bUfCb6bv+ˎ/~x+Xk+vIG1X3)TaEo-#&摁_J'wOʸ*~=MvEliGSi1,"bXڳ>j`b=BVEI;τE5(`#֥:/f8''5 ~OSONx4=.hsLHw<m&CVEr5W)- fUC/mP'Þ3ʔ8/0;/-ҰPO}yr:}M5]鎤y?PŸjzҫˆq7>d3&CȎWO_UaB/_,N@<(ZߝfE|#do;m(H*8_4"]O@ofuBvF15o_6}-Vegzˣw>J82TFKf>3Ne"A[N#o ;Q^o'c~oc/m@BXl~.ONЃo vE)~l57UWHXkk(/ ih\WTѹ:[q t!_li UI$b-R{!lO6U 8=oA*X!MWADC_ϽusNV `ݦv:0Qy 2A=lZ!u8JzuPaoۗJΨq0~]R6Nq(8}Rꕖ3 C43쳦0l'"X-,V7z,'{k;zsD4jl%spN@[@GF*[mz3t'˺-[uUԻlp/JlpI;$O<;ذBEb*ʘۯq~ۃ&T.Prs]֙d̎,.$YG$u$EG4$b)IaS8&γqmv[ {si%B(B|Q|:o @3}}@jpl:i>kR/tusgʑ}tsa=G׸ŭWvZ6 Tg̭c' έ4LSIyyn9ZUN"(%;#_O2NJ[z lRa*o+ЇxiE'6;󶰌/(ym|pjv (0@FL^@ʪ<6C,O-fNhbgLwfA+nU?m@}% P~f^~;8-{>C7C"ym%~;2*6}1NODr(a=1%r%e,(9u<6gHћn^Y7Ta2z6绣0g걢CsJM$?q@?}vԜvx/!ɪ HS"|Ub~`&e(w&H$hauP B2|GOe 2C,2cY"x%ߢ_j)wg=sHќk, HVM둯_~jÕ}-ӭ5҄#* ¡zؕa$ºq _S?1n5+]QڙS{*w4ZA!Py_W-r#: $Wb0  FQCs` 0H9_J%@=&-_!/!?k_:f;T0ꫨ2Y;kIyҏt'@^l \ޣKl#|pR=P4i"{: ~6TjPLEE(@rn%hrhH]b EXD)4>jM2.z%H9 C MmbIAYG˼khW-f!ZTAHጂ&vSpFDIV͍D}";6lWcIx}yuLjj@mz(P'r&YkbzuP^LG{]H/v|;P<@OԊ>d 0t,Zz;!NC%#<1L'6;6ݤ+SEw{u Vnnoڜ`)O/9HC<3s 9HR#Z1h8v}|wz[zִHhrK%,;JT 6%(X~ [7{;8۵aQfA8b ?hYD9i2;^++NgI$ s8=ϥlLF纗*$H3qF%+Ee% b[ID7Ar!>5qk$xx9I!~DL 2w`FJǵ,mhQrDm(Yv[ ț'LvMwƨ9ptt`_HZUeʲVbb?U+җp/0 i3o"șBGXrTKׁrP c3:QWf,]C! G׷<6)NCkDqpA~{vP ;f| e~>$nŒQ7 వ"c`|ɼuTdB)Ž(^6$6! &j >ΈR2PUP0ɬ0tDvmk-J+^2jT"Bo$ƄG&^<,oٰ"o泩*nZ]F Xf\pQڭRJ?c|ZW~IFD[XaBBrbeݝƺ皦UVbz >'8\fܬFmXNB̉Qô= t! c @QȖ/#d|kjS} z[>#:[й(م)Cǭ%|SRh`Ӿj|e}oŦɜXm.}F`Emݞ`۾ӿvK8fq`tȗkԖu@ċ;їo`9/Jw^FQZ ˘ɠ޾7u5n{r W,Ps5I GleJxkɸ⊔6Mx&36ȏt~ u8^s6D'bgu? !*;l ~^ (dׇ)iދn"BFTྼXӱc[V? CHڒ硉ZF(;qO{c$2|1?bP"AL&c] a`D|Șv%u1ؔ 7} ġ {1mG@Pƶ4S*6 _!ǂፋ,kvhd9BZN[?`; ~ZS5pKVD,<*uW3ݿT&$\_=] hcw4VZ2b?9 A,͎Қ8{e[z'z֩Hxz9M$e-k1 Fmx^䪽|7H 5.WbSK` S7)u/H0M#6L(nNƀB:aύDJKʹv1NGbH *@ F`kHmXǘ Zi5in_H_*{\Lso Ic3cH=eY/?iגHZ*'x44g!wl_A7T=?3|tYb~5U^mC}J"YoOĀ0~cbHBk*փͽ{Me3ϐ A&F68=;looYKS讛lh2zmn sCƐ9vr|mxN%к{x/@^ҌkNT%ǡ".W[Q λ+T2?Ŵ@oafK"a8r4"7^lJ u6>e:r7KJ]^Ū/w8B`ݻ$q.v4DpGg%P&z\9y\3rc(eaFF9 {;xBWZQWj$'* pSDO fհT `?[I%Ɠz;a5Nvͨ0 .F̖;ѥY+O7Z0*b#cX;*(h 7B6)E(+ (:(j8{i*h4j.m k,ڸ ;\~a)jJyOSTOioZ6jr76 f.fA:LD9}} -T[=f_PIKt-7 _0%tjRB<`)ۚjee{NdE- >9Ɖ~o.2k_41|2pK\c;^*P[|AǔL2Z_EΠk±%qF]>9`vëc9R3Q@\ydU0='pG X=7~ƪFſF՜\s :%L˸ncNYzfliEw!r,,HRuo(YDnB떗@_.p |(LbߥCp$k/h;toFEm,E%fb0 ؑAұk4LxM[ݑGd[F1LI.3{,i$Șb.(UcV;.R67q ثԈ>o2 ХMׄOr5~s ޼4)-8xLպ~R쟦J.^7Zzڷ}rb ^P[q2r4}|+wټAiA֍^j_) * ,Bg]js cґ+&SvO>TR.a%{B+:=o*T<Ҏ54a델R}\:LA/Omѳ[nOׯ#L =4yޔ=쎏VGIƺDۂ2:Ȃ#9XR{|( o܍,{~BOfpAdn2_*&j|/lp&?\DӞ o rd:>I#P1/|%@O4׆ r΃'ApPJ S8hgz)F#-RTQ-`;GE)P5C-*x PClh{7Jiwb 8WUH03.PjZ`+Ӯ|=U !@3wdsd!U4ilѼʵzrymG>a*/ !2h{n.!&{ DKS*aB(Lkϐ[9ӟzm \zȩJ낪bP{LM k&ߔMCV-? miV-wSEfXŶ>"; 7Udx,ѧHw#4]Psc̆b8$sM{\H_4|@Ylׁܑڤ?<,o4\gK n<X&ٙZm8/Gdp2{uI0$>_5'L!ј4bW8^ijs0.DwBjý{gÏ;hSL/;8A7RpPշDGg{ЁYkLH  07Sq򅏐@as}ĕH7Z6β.koDAW8X$@/ ^40EDt;2 B0r zg 6x)h®LfZ*) gVOSɍW\"2}"p6-ҷklD~DgD{^ggze+JW*PF dCE3Mp皉3F5yW>^ĮNRӯ2Cu cwHkqRWbVa#JBdlUW${C2=r7+mtX!I VYwbGSrmBhѷEׂ߬oؒ w-( )%ʕ?%bU4vf4L1N3O/^Ym6' hmtW.3NRAB۶S@SAkRo^4yQ6+?8qj{ n_+ǵ,fr-2̟L>^ZEޑxٙL<-CVOOܒsiwM_#<%yo[r8\?n.u8#O(-keNt0M.`02P|072Y۶X?Ve R|0UMlȆ~h3܀X"@:xk~vgF;M&A gRkFr_~C/B-9AodgO0FޚA?QJ=J8uZ:PքVN]"igUonO8f(C8 {f l'LEI u>bWz~u}>4j~!|$싀b7fuO:&}  < k,iNY#z\fl﹕;zcTz3j±{UqYlāC8l{oȦM-v9sǢƭ "v#B/SKɤav8;YwD<[OԒz@ՀB}bWJ6͋o&I >"dT<2xJZ,#؁NT>D³NeD¸ԷMzcMo μT}Yo 'њ<EֶBuٔ!Cu0jLƕ{#"pB-6u}Q˖]%X-b0uL]C7I:P [\ 8q﹃ % %B#}:DFCDeQqU^$ER`e V_u6rtDbNa eNMߢ$Q'hwX oN$⳽h̑ywR<+x^f2.k[P}InhCKaN= x}C1nP@vaq+P dǣ@)x[i0$&=~ uwe ʅc:?|R3; lQp;t{ U>B 14_׶:.gF[b(q.o ,P=O@_[ijxixفu<87 &<9Jur!'޿ʤ&cLiPa~ "l>tSK h(  2~vGzwzCi5ozcs:1]m6[\~O-e)O/},g )(fYAGPz'־e%FP~s1bZhWJd)̸W x0b(a!B(o%2%OHrr6`eA78Y%Pg (HH6Inp;!&j[8*m{gyaA n@F4N@HĮMrȜL ̴4CU~O.;# lS1XGщ!ͽʤm+]׾Z a{ oKEVI4(NAy) 7K7 Yw.Rse/[o-T|?12VnΝ IŲY敁Ĺ[vX@&~btC5nKT@CneH5!%iF Äߋ|  w:X/>u]0'}FpT{YYv K<T L `F% Zgfy's|~u/ XtPk z3)k6}*VD!-rK_Kfm9jp»wnIHvgkbgx;}zQILcBNz* r@Pb^_Rj}h Kb/F#3\{U 6ܶ k4"A^d䍨>g LLm\zD n:Ql(~>JgFļ(ǿaVY1Rg5|LrD34,/CdaZLHro0C }oS>h inWD{~Z$1;ҙanq}I+mC3tA"w"z$˙Fa/„$S/u߮#Y6=%~vޚ[K!\ }|xN އ8WnaOђqθmJ찑H(m=KM"^p=K:(5zrC C;52pu5i 1sZwcr$~^#̎o3Mx dH$α8Ze0eDGu\92,/5Ih 'qnEd^l(1>s}[Ev6~^0ܗJP2oŞF 8PCh9DQȾ2WwL؊*]4O|7E&= yfB?tMHg[@QJfjAųGXX6S\kŤ!>rL\<ŤRGhf NRWAmzQDR`9o.c 1fP`ô⺔b "cPHJxI&Au8(ase߬ Sˉd2Cp |آ\JvY>,0sF~P`GjF2 %цW-$KfXK+ݼxjz.=0䂶zozrY:2ɏ@30|¬DӴӞ"HˀVUק|B54ISD!_=&ƲoPuͰ&<2if\x]Z/q"lA~*K20^kϴwWv{Z- k+&QoldF/@(#'Ӵm] œ |)- rI8G$uy bЎi9&C*QJ=J:l%XX%>~Fwءܤi 2޹1 8Fm ll;{ž f4si oΒNRUJhCM6(eV0~_̋ݭ5 iOxyI[W ޼E'&U@pGZ)85Ed+%1 ^ O__3F n#H/Aز2t\`\j3obGL/Lij#/L^Xk$6@#$ZQ.K`e2#P-id_(u]ZRoĥ nym?F&/=nL=țqkT+9aŚVb;W!Fˍ^X[YSJ2$ul.{&ZBR3s$u!]Se!tO_˸u]͆hir%#(伛Ȧ*7HyL&0caz\Ta43J,}d Ԯfvݳx,iq( L}5(/VLk=) !5KQmpuQǝvĢǒ vV:9$~R՟b FΨck}3o釠͂}~{6[XUs(#"5 2׆dB[QߐYk*hDֳOͩߊ6Φ7F /ńL=Wݿ;iս)3ȳ#`WHiz+CMsb>&_|5hNO rZ6]Yk.WNJDZ81hNDR鴶}`t:.@=,Ğ}Pg91!ʹa˰=~-wF>Rf궧]FI129UkY(zRI$U$LSj S s":EuI4,TÚ/pٸf;RV[|΀"i;HZc܎k< PLlS0჎?JXO]xT>#βuN#z(v4Eu7$:.L 2Op?˒VӬNh?xڪ4=ȇ a%&tֲHpX"sL:e LML[_vc N,pU)-dKXMsyKE*B RKfZ'yp8F?^ؚ>ZgY?{?U5LV%nwcϊ@ MD 4@6ixJedA|:tzXDJ sÄK";0J(pE\g2`߿w lVvaLau77*% kII9YGa;ND3۰gEFH-gJ3!61aB7KFDx1ojsZk=?DG%]@c74Kƈ;@lsDcI)#Skq9=4W %S;(r͚z(3mq I!=y!^\7*"ڎҴ/W *Mߗ.0a~.Aaѳt : Dn}+,*9hdD?p-R7K7Fy\8 N ZL=#>wn u<a?S]D-.&Jdl| DME$o|sY>_٫;%9ړy|Kl;o " Zk#9ɮX .ȆzNI-yUwXBbVv80O,s^(<ghQpc^ڪnti/jZdAD\8n1U;<ц9+5 $RPw&gBNS|IMk 2w쬚gO2eS{mߡ%Le( *{Gi_?tqu/:\/~b Ϫmwlf koыޗ3'd=| y '9NƜ6Na";OJfVdT,qAlŔ7{a^(RT˱)5j4k(7IB4;wHRLԵJAX@LL.V?Ey~W!2vh]a*|?x8hFt=K.*[zX+BUՃʊ@J҉B&`9mp"QS1yGFgjc8 n  [Ԙ˘q-n8l? -_3"%ȹyv0H<0.ԓ8VZ^ݪXȾ<2,>Lx /|>gL ΁+6{T8r3>C U羧xxf@Z%y1І[^RF[g XSJ5gMli"a8xx/ڱ%O. Uo,͌'r§zw(5\`r/@{#vqGno_OcW:@-Uu/Z: tüϱ+O* rىЗ–L: l$v(1nlk" Guo Н"@pڏj̨c/Pbm!;'Ъ&κ2ݳ4LT](tLܮw1`]r j@?詁qm*X??G疐˭ M<`wxR],ඳ<86)k溺I%~pa2sD@LS|p)8v]"z8=|x L"q`}` Q(Liҳm[ޗF8rNZݬI 2g3|7L(Fu"T(Mؽ~y΁@C|2nH(eJuc!F*w%f4{T%ƪdz++.ڔm(ڮ4]?ɿUfa#L XRl!])v{~@aP8}N:UtSH0uD!`qv.ݢxdgD3/(DNY-Fc.`4UoSDݏ;! 3XtvA=b$Z9NB  ww].:(ӕ1Gf,I]Z=VKw|K&dB6v[kt$HNJU3+\0 i!YuA]U Мy{zϜ:6ZwccJRz#BV 2]CsϒS yqԍILxs፸ABsu(W/8 LOxqn4Tf* 4KT7VZԂFӹ#_S2WqJnb"u2Ou1<`ijwD9*JBW\Q杕-QKʝH+)wzM"*,hE::"z˔wdFs'M/֗>+ѣ]K Dr|+xNpfE(9/yة<˵:e⠺4q~WgH+'r! A:cpj;utj ] 8##!,כl~4QWr{Ū[#dHuz;aBط }P(P.8m꿯 lWτ2smtt$\rC'ܸRNǒ%'bAf㘹[6NkELqGDÔ`@H}ww{ i]UpIcAl1x ]BO+*i>8eE>h<n~+$cSp.iym]!C`P33a Dx bZO?[%7}{8G H!AN052"}ptea%PXqXKB=V JM0hgڼ=Giw#+ %oqk(_-?~zݹ0;xwHpS+:U4JKlnI)&2\!9U{ؾoTzڂ4K:K8 5iU-S>v%zzF< {mC GgըYhKA4,kSmj;IpoAW0P% P5E&6Ot@F<M{ք"OV%T) X62#75GYA0FA,!V&4E׏:!SѨgjNIhWs)eUnQL<3&XHW&w`>>"6.o@]^B(̐Aum6 U̶̅6,vgчIr)|Æ-z 0R`^\&kǨЄ8e`韝2tSOѿ$'>>Dow~딮*| 8Gi.}Q:r~˷Bw4xvֵ cJgB|DCr9< #DƀڜpT8cAIgUxX湺K$#=[(]g_^mm'+z9*څ^@Ū`tuS{ Ⱦ&(N0׿!V1'Azp@C/S=lVy-s+V<SD[f̢̣xYငMZ_W xtR -`/`oğ3CI槩#zQm ^B澬AI[ a(2 I=s8Lh}ẍȲqUaHGBG4\[|IMi7OxmBl:K~`mA?k~*6=tLpTul BNA3&Y¡k`S88P:ZjU{joL'z+|cz w,86x;P2z9A<g>æ97)+ "A|VY~c+aCcry5Gp(Az/U.Cc7Y3j;~Ԃa;]!̐q|ˋtsɃy/`&*߉gRyB&Wti!vquАo:s㈠ThW*IjU"%e5GF߿8.Z`[`2JO=U߸7親ȹʰf>/*;jܫxr/A7>AOl@|D*ךO b=g:.Qp*dd&+pl 5 -2W S0smwxue i~p`eHE|lY>8~boB:Pomg|Hw"Ex%9BVnA?QC24g+f\~g{KvBFmw"ns*Ù7ead9CQ[3ӍuY !-l`0_5^nR(~{Rodlar0`RVW^8hmPԹ|ǯoPU;Ӽh'v'^^5h!@R07}W+U(-S+dtOԨemܶmYP:tlEsxn4p_#'nGٔP1l1dy}!~xӻA#\̪ D:Ԍ\}bo*~W{L!խhP_TwKP-%WzhuTS],tcKin"n[v{Aݏ44'SDY\fbݸR"%7}+|ME/}A(L4J%i\@#HB(J!jhU!Fwohᨏιݘ^YCE"*C5uӀi9C ĕK/ϼ ~7XCU$́X& FcE8x0]9*#rX&d$yTaU9,?U1Y A]+f!xb'nI\юP%PćNgKFI$bp_bS55_ؐ z_y HrřiWВ tVvBg[|ql݃URND.&ņ5ᬮY ` XC*d8đE?ѕKg:Xq{gG#PT%{`k "y @2 v./:9 L{&;kfMݳ&Ua1M X&.j ZpG6GDooq"tdF#/M GQ̳Lϳw飇"ŭqҊ<]=& u8<.1)h@_l>V\bNGnPv Ql٠~)O/`ODBqw?G}^0Y!Pڒ_,p5:,@1wXu%9%l [.FO4O %%W=OaeW4NZx<ݧ%q)ЖF /2m Tbj0|Yw]f¥v gs{5r溯j<,nA@hanZjlAx W gJc,x`mIMʋU- <`,>vG*mB:/j65LUcL84j#c>"~R5}+U0u{12neYW7%`)S7nխ@ $oGG|G~#gT^XscԔ}}L7=yY3' (~ϫsVf#R.7K_ťaKa}%ӂaЌة2hPX< .)V7HB v` tum44Oљ# Jj@#shF6wP:oKBAj3pǾ펚e; e_x,r-pH9SE᝭_(J]7Ad=-\(o0t,6<Ģ.YĹ 8xt֢G&ƦA{%?ba)hɘպp?J;gw7ubhu;^Ãr% _&p _} $ɸat[⌡vyn~skqyC5Qx'ڝ?T.#m;DM =$gQ?.)YGnڜ"?@7?2H)bL#W4.F |8,Xl9ң)zbէY| \"1H7Li,7TO@~;nӳufԿZw+:*7#dVa2(Cf ^*&npalV$v$N}~mB6+ZLq. B0'cGO=QL!VN@z]L'9{Ҕ/cc #E@NX4 u31+,f奾 G~64v pU{" [׻ccWi=7h2}X޿W~||}]PNi=YK? ep 9\+33t)bu N䒼k]}SH t֞ LbՉtU荞S}[ WNeٰ!fPǪqڬ]rwg2m9keX_'ob zh&p1PLI ]{gFK.;؄#i&;T&1e%"Rk>DCKb)}.kQ^PdYʘpxFTBI"N~91ͨOPz^F>Ѧ̖ǐf%d~D7PGKJO(J:GL[ӳ<3mO(Q+Xom@P/yڼAt3f"F90% WlT4Ċޢ=>F:V4^19V\Xn;+ QNt뢇=7BMin]ȁbӍQw8n-wEc|dҊt"SkG1ĭr˿06 a  Ρ|xXZ"yI7Wqoج>#Cv0GDƄcE[ƷPC#*&*/lPS9ct4"8-7/bfgO"=#ՒFDw 04@=f( |PyHYR92vʹ S2Cla?K˦V)׹f@}hj@C|dC76L2/>C=2lt1{N8KGTόƔ.}.9g59 |c`Jv8q.g%' ^XݯD/0x DD%&d:BV#>@90T,Ʈ?Sz*$" h"-ȋIw+_\B ݭ[Fshn7awJ:u _}# b%#47su 2=y%1ŇpYŊ.F͢+#x%K$]b!-> txW+6֏Vua4B8 .Kѵ$Si۵0^ $z_ⳏ %OX^=^uyi-ZLćޥuEa&ٳٌ.j4͟I*v0ub4VWrVL=Ö\t/-W\c9v$OA>0= PJpXJ&Vf'!g=* {/Cد>5Ywӝ 'PRoZP+(;aY4wqvشePa@t|T]LmazP }Sʩ$,\ U2&.v1UDdB atsz'8 pVNqm81eƱʐrA i[[44 ㌙IDgxAV1Yȹ9zYA&y$w-QW1]9#stu<!?nB,ĩxK+( >ةMš:j tc@<|"A" 7Bv"_I.OJӢ#M{fp>[Hܠ$U8ǁ+wn-dqx#923ۗP a8ȉRm؛?'H+4]t=0t$ < ]8nl#gyjrvU,1Z +14mJzd?=ʉdOj&T E[6GoS83?ֽ=sv0>,U 2\a =9e Se@VvEq#nX{U!AK8{Bi22\vW1$x\S%0NyVpZѡ"/$Zgdv @r;ծi߻%+?>[: Š6zӐN"bCD Ӊ2FٮJ|aDT 'h[Dn9uO9D|%Jh$SP7ǿH9! *sCA 7ԇS@]/f b4#oE5WJ ]OE]ç֒"W ?"_}R/%1hIK"dw\ɒ8aלGߩٻ;PhI)ჷ rsW}Թ48GطFD52ᎦVMAʞ ,rD3']Wr8U+N‘IɍsAFkKƞB=-jkϮ[F{5>]0tFJje=)@^AQw,^H2Aqvh.0NS$} ǂsngn$DL7ezU eB48@ԗ$:_;#x/QB|Yk!rǕEj{V䬂y fKn3x%2̉Kx -kG0#xgxCBk?В8(s>k^`n2yKGeT1j+aq }hH_M$Zdo!͑ @g݀:YR  l"Ew3TaV['aS#Igq~C3 2+溒TWA1g {#h},25F oVpr|%KMbAs>y噞R!Cz%u]-cĿJ)t%] ^P&Rp#Jc%;R2pEq-vD|/63{ç{`mX2 Uh؎Q쬿{iYdE =Va=-glA.h5w7Tg@gB~7mmM*ha`Wr09x iWUsdh:X`g@_ߙVWI Zᰪ,E]!M9EBNlN$b[CF}VsRTT Q֬f{5%>5aW)yr,K"2- 'JKf}Pjj_21B֫?p#Z6n,vлGolo b/1Bs"6̄GedaJásXNtN0n-b9ϑrXy7B+)\&?y 復y LB?)Р|LYqنWnr]إ J9p2"G[H4Ōjֲ+P"}O:$.d0{ M?q~G$Qde9*'-X|.Q;H&7PS~x+X"nf+!)R@u!":F pbARwgu zL7=CrPl9J(k-g}AAL$dp])* dO ͋4ؗC;A r/o0ڔ(c˭{8EXL#5KE@NQg0!^{2;"U ֬Cum_ݘ/LXa1xzRqmȔ#`-1x5q%)~'b9-kiDy1:}yo1݋DN|壠sgɸ+T7oo[i0Zѥܤ`JJFxLUR>z z'd}1QWl"oM؀tls/&bTf0H3"Q7.79Xf3hUm;j팫;Tlܑ\8&l~ުbpϋ GNO2ΈF#BtP0=z0-1~rF_JIxQ RF1WLS&D_ XuȎ܏3*!/|:=c})<8PM` D/Xbhuu\J\{sJpnً/|c(4&㩒` sgk6CS1Σt|nGs87}G ɗP;tT0Gᬨ$".nr7.F+TVEEÐ2ܓB/Ӵղ9K'jXЊi-nR䏓$~7.Vi⣑6o M\ՈO\K,eP'ۺQt\^.fJl*Ό`o7-]3G bhNM)6?DZ Jt <騇vn [7*f̑ ocEKZ5}V'&Ƈh BIr,; W'Ld~wry04͛yqk:Sv<‘ mpkv_h;c!]{4^֎q(.Da5j$|E4,GD[9)2>궹n+ N<*`zzd73.o> ~& gn]jbitĊ=*!?m&VņZ#>'5Vnm|(MS~[.TQ-݄F(=F{F\OMpR^dP쒧IP3Išmc^Sv3LF?l1ix NpnuTR',F<RҮL[1k|<\`Dz!^]e☎ ŸSlI4V4^k\p#βtb8A\3Sl</ZwF$&.*o=^tE{a4XxԻ/Krxe%+[wBi"<t* u 0@3h&OX9e=2"@ӣh^u@eVCC |lF~U~ umI^Tqz F:Vfp {A#tpTؽDz]ۑa-I%MNW?&4D 7h}Cb4nNsgz:L8Uigi95o8Q?Hm"eh]0^jmC5aH<q Yts& X0UZ?ߕ;Gޒ>YK6x G_R5v!δa𪚀!y4$(>.gLEt ' S#8WfnDV6&6 ?O6oc1n˾GlA81>mN(ZC'Wˇх9?jT7H儨&1hÇ*57F"|^9Hc]U=ֻ6z!& D{N:J  k˖|OkuQ}2ӳ$$Eurfcw𚒋P dcͬ&Q+йOqpW0zryo 7[|7D b4%pEpefڞ>e"yDx|["aR%K NdT3YU&&8pOiٝY8v7 Zy";,r!]ZmGXapvZ̞~N ^'BY}%V#ՐF;M[61>270{?Eq?#ZVO*M؝uz-UQO)_<{}P8KnJ@1$\Iq> P+`l;D3<W4))%]NԑF> D C.5_*0h( kĀ\*$Z""Jm;?[ms!oև:}>y4¡ݔkdI͢cz=?jeN˯%~řG7/Z e( To8X,] 3 e,ݱ;OABjH9!΂hC *ݗYPPӬuf0PJt9ԝƇ{AUYav _ى6/Ѧ$f0*9.Ճ|q~\aԙ-d}e|p& Q) 3} K>b2A_2 28x̄,eE+~h(zuN磴lTG|B(ui 2&#ź-k_.Ge0 K+TL zYxȼ=V[]@юY.2IFRW95})Դb{2nɅfR;DXa{GI$|~#&,ȥX#IC45R8surǿPdZ&edm+p|^3 {u 6K%\</*lRI*aIe>I?ez?r3sʠIW';4?E~4Z ?;u Kz]x~yyXuDj4u pKQ:mug&.<vpQdLy "#SO'Cf:``Qx[GQONkZ$$6wU3tG]ªEYI}>M$Yv`5] +<߀يK0!P@Fg#LM=p1aoٚBxEgщj!22ۂDPNVqA7W?$(ƦBHY$VSFqjZ>`SH$'FצQXi/ 8* ZN]:SItoDO;t6EhBttakt#@„-v7" $5͓fA,~F+eSY2ƤM! oZO" EԺ٥yf7cE**Uh<1J6dpZjcChasWc;, ܊GX]"nzL6E: {upoD zuhO,׸&sjl&)%I( 4^]x0B;jD͉^sM['f'r%VШ"j"aV<ȷV*񻱘Lb2"O[d`Ĩ.Ȼ4ܦTP4:Њ(DL?GVqYRnk HOU!2BLV'bH:6U5 %]/$I|/n%v7$w#5iEqac9:H(Z&Tˮ} Lqswn%" ^B'72ZSAci%l8 v*6 cYlH]h3_i2S@'nNnXsMD@Ay30eY3vԺ9N;Օ,PoQEfj|k* ^1Ctz/ JZ o^h@FDϥ _(voF&ȩK8}ՉN)YhGΣ;. >&_<bp aJQ+P[{vRo-o!OG,鳡]|2%mcRJA/!RT\PR x/rjLhݖswrӎ>vM\-9dqUhoA~QG&2SU09뉨0't'@8YNH#td/i^ v"?}[ =uY,L)]nOk1RsqH,fSX$,?GL?eHJN'CbJ7ƈ̧~9!Bsx/"uJIۡF$3o)^l)1.F()KyJVqu zDŽʘZ[ekL 5x$kA>8 >v.[8_Z0 %651~yo&z2߆*\ZSC w8Q ŢƿuQ;[M\4\#i NoP2A`\]-@n#5R犃:^IҒ0KI̽Hg(&X]zg#LD_NRi&4ae6h- XF[>΍a!(Oqe~Xs5Ϳr&H?u<KYD,ː5L;59V-q;VY=`=?UA$ c6B?`}]$ES#/ %dM|veF0*i&%^auD%k_3jվ XDfÖZ H3k؃e.'!&c Z4O;\LhҾz0gNViRx Xe tWo l%2F1KP(5 e H?n CIPtGf743 6~Ai 4BD\ UT4)v o &+<[}x.ZΞ [ khՙC;y-خ@:*b]ISz~hPOdvCUucL [̴'3i^}tV'߉@)Fw,FSYU#.jqTpsc&Xn} QK=S'MC@_ #Zvټ2Z?x3*q܂3yL;K!A/-K/LgH8ab?Uww/r9MiYȖ}&KSןObݬym~:mHປ !!u)W7!䦈0LQr gvXh +tM-@0_#:¹~re/t_D(j#HOQA0;D{ fo9G:<ΐ"c;Ҹ/ }w3ex,E*efPD_h_xOHW!K'Hqp7?UR0lb;.;ymqdC@LmZx8Kl솒;>v#LrDZǘt }6h6[Q[i7P$'p,nx o,%u|]5UV) +C)ޤp6ɺF&STu֏ /0y볟|m&D5`LHغ Q^4Zi/\gDbR2)7R{cHO):zf֓k7~**R"$&< vtȯDL}Bjd|$hul%|dKFH*|Xc_1|W)T/ h {w] f{֝#2lp Fdr)RqsxXTKUfȘ#aR>̬]!' HR 00)aaoL~}xC&3G%pdG9Zc3v[k )%T/X 4,40G(Cc %P]k1=T&R%6k(OFJSBT3a@OZ(P&_WrMӠo ~Ҍ+][-Ο:a؞hVk?=KE(u9^xxgz+1f(^c;f>Cݎ%& KKΖgz9Kz ԠR/wxe,dPVHZ?$x# D =ꯕVFq/k,CX] l cZ~ijd4TE?~tUe x`9=Ńy6;ȵ)/G7RHM̑HFxSp>8'?q1DёVj-!to-'_PL`pˆ͹Nq.qN+؂b^٪NuwV0g$fy뵚1"A˅@DvFu 0f.YW 7StV7MfF4~ca]@B!R,1?`Bʼ|"EIT#Mxk[aB*SzsǰnܯoR1!NtOz;Bp%4V}y&޸em!ةk~A w[z/bk?yBAq3*,fQ؜> Q|u ,#3R7Z>eڈƹ|jq\%-eѵV$M_"8!.Fa zgcW|=,['ed:E)UɏGz8I &tpp4oxJg >) ɘ'5:j F7<'''#R.''Cn6 ɔ߬0!0?Z ] ـ?QAX0I!5O;wC;0rDR7\x^U_FoG/i6r>$NpRUbv?tRy\d 'o J7ˏ=b'Nh䧶A(>.#J]jwT 4qX *Sv\+t|NuW+B&Jo()X2p-LyaŬw3]P_("|qxݣe;ɯW")%?ޑzdШn[m{&QkԚBݍ־V$NeA8miy mF d &GvҐNF5ɸ ||jĵ^˗!FA1Qb#`;Ѿn,^S>Uky[D_̘ a>d;[ c j9@:ʳ-`j>Zv}RuWo7}ߖbwL" LbvTHhyQL`($~\XBm'`Y+y*6qVx|:1^Jr1AreBvBRXrbGI='qAs8nsg ,GU; [],pK=RۤFJ+[JϤ)<8M!$S°"Z[R;m$qó=VTʶ RIЏ%I,|`:EնZ4Lr=G/o-B[~զ8 S&-L8F}:gb)+-HPj͐x}y19w`ŵUdj^G}G *= 7k<>j]Io>Z:@q|JƎ4@ƢqT27n~_Y}pjXf!$ۻrX(+h.7vQx/Af@b}i 柲\Z(JaXdVԘ;Pk^=Q~zS"P|Q6_"R%s^4l94~֌N!CQ2B6{a}0x %L/7e0 PU8':;mxܕ E4E]dK׾T<[u02IRL̬S*xWZ_޹lݧ͏iS\P8 "͝U\ðz*"k`J۱r&r+g22kJR\<7'&֝BlLK/D[e*&qKGlB|;-KDE<\sa+%>:xA5|J rKO ])b`T﫣씏.<:;Yo'Ƞcr{hjT]{4?{Uԙ Jeӎ:)'ZUüK'2N~?YmŢ^Hw_:Qo8ONv,3Tҁ{chmL~Rސ:#9CZJ_/!ܶ1:t~,N-QT H?y{rFJ )ZQK-3,{iudOM*c ְڗmhRBY1 ޟHS{fcGfFTC tv*J fvYy y=X6 yz9Fd ҷ C ;`b̑tm Eqz2 t c,ڐ@N~T7`DǗ>:'8k-|F!?^ᄻ f3E'fQDߎ0h `%̇ ]uo,Nr+"'-'BQx` j}1d 4լ ф[ DG7>hj w&{u |0"oʐĕ2C "d/hwO`O|-s-$<!iWlWNsD x)#H'hң>} YgvJ-e2jӯ# TM6Iو!灝I7O{FMM<[$}MGN֒{R-?Kp FeOO!MBB$H; {`@bWT Jf ebo87<[ r/G_Wk lbWCk*Cg6{e!`2[-/ؠRx0bAמ{ MjV㦤iX0\C'v ~"㺸+,:ɓȞC+R9芤(#BL) C ccA-?fQg3urd5)4y l<j=^`'gZ-T'T-*Q]mj4~mxVQ9nۜczv.57"7c?B㾘 54A!3mXp އWRl ՠzqڜ B`gr,sֳH#́ƅtmu"4:?r sZhzŅ"Qrg \uaI-DG9VԽL!s'/tW.vJn.1׸HQ22 ^1h>"k9ԍh!ǁLPu'Tx_ϛBE8rIFioH#"npZ*[8*m9#i ͦya[^~|;P e:f^G@m8~jBIà5<ɋYY1ʡP:9 "6 sKxf `MGGy"ReS| H(=@oyzxdu؞D" ]AF7Sq uOWW,WFC+sBO1b!Z/ V3圅,H6z\4X GbTԛ>GrŶ Ma]fU`:8vç޻q4m=6;yס[YE ߶ 5 BR-p XxC;uCf=!^"/e\7OM kG#*dw&x}͕"dµ $jdN۾P`f ~wRdԢ_qu 76لmr:^jCgMl/Ht*fW\:2W_u2̯-nw{z<&hi?p OlMX{Sh:iq{,m לqx6"o8Yh.ͥ dlj6H1tX+No%6 sujzヾ]fN; j_lΡkA|$U[:Wo ^#XVJAZIcF}_5l"vl&EX>y+ԚI1xڝXB 1ՙ"}^F3M6P3I):`Oe@h32 Hu<קɽ? iεCeׄFaݹ1/KH_~)\mt>^wX_EKؕiMgލ*_ xόUe(=ᶱf7= MUD_qPstTƎG$bvF-Baֻoʅ-&ٽJT2* ܝrA7J0X #ĥĴn"jב_K,we;$EeU3E gG)8:j %iҦ%?ِaypf7N4ZlP0[D#j'X^UWgBN}~\I2*_”:_RQiHkvn]䙪8| A!IGy4f>!؛tjq9AFKQGgρ]UP?>ʄΩ5{Ge gM w~ ZA(TzK?VTV(^A,j-$fk6VsJiF,ɥ9DZBpXKD>`,]v| eRc-J=1PsUwA~M<3ʡ>S2Xfފ:]9;h۝`żq>KZ,&zP2C·+/G-mEL[1㳹G|Jmk-^Ǩ<`B|,}9zc$ 2&5G_gHd_|]ҽw }NsmE .Il,6`MfjvdH0wm ]Ó>Ǚ-Y= GPΟ!5g͜YPsqXcܽuR2 >Kv^v taCV},hs\B3URr[%z.ŷ m򉧐3Kc\`hkN Ҹk#!t͌IDA=a;TgiGЍߖQ' WdQo˓$kDdv"o!*ЧWJ Bu meNtԸׯM eFDԡ5F &пW.s3G3] p+ &ơ ^`=Sr܍3#v#OߊN"$[xՃys‰o۰'!qc#8\:{a!$k+KŌ>8|!J'<']k^0^ȮEV/݀@5_L^.T{&M `G}J-TДC SETM3Х`:r;xkyxny%/8MÎw8N5d #ߓׇ)A b@B?r^p]Y$[!cajQjVJ 3# ?OܔSިn862Zú,6 ֏Vg$TP"ʡuI|m5e72x0_#[}ާ$>U˟: Aď5k7UXgyڻ$"))# p]Ѝe.|)e.S zG+ CiC@Jo/oc(Oud؉3^)l%ꢾ1*IiMr |篱S-ęBv3{[r#q )r܂RPĵn{ƒvt]:0Z=G'GJUm)n̓93BgwہAW_x;Ȥnhz:ǶA"uXzB jink[0UO-LGJ%@|٪<QpjFZ2NS3l`jkVE]={ܜwM)omRk;}9ՕY9C;Wmfˈm0>A*Ol{Ta2@[RZ ~t11[!JG/>0џ7Sx24K@t U@"b#49qB86A !J] ^So;L1o ~Sft^]CN׶W.jVEs= 2QrR!M$U h.5 {Sm$O";#/kپ"G(Y5Of&;2+V3c}ڠn9;  2 nϦNӂUnf}렿R':`K2D ᛾?m&hxAP sh3<Iߝ9T7xv rRF .0@j)Q `g wl0Hb*>f.tK ,P)+; `\U !Bl'-hc8EՓ~M("ai@̦(,U55-Rk`1c {itಈ1l,?菇ɀqUREBغe&顳5v"Ɯ\QyЖkFKi,ׯ`d߀5O32zk9¾ rIv]Mߦ}N* epe,%چ#z_ܸ%j#oZWV$[iw<۬+x{_M>x~jia x}2yF Demx!u/nTD8.EtYkq+[j%z=I-z_q 7.KT `h\&I\+x'yXiT\]ifŁp~u;"*x X6l8 h JǰͽYla5u澇nlZXi4 FE'YɽƽO" &W:r/S[I0wȩy?D@Y_S]D紫d@} q3b|AyC|-qWOU%sx*.NyT-ƨS u#6es;$-}͉m$/lNFDf-^. vL`) DCr_Q.컋1}1Шvd.Z|Z`;*CP,/dyL\yf%K&$]x5un5xhB,HAkw0C#ppάN[ゼwCQh̴K}ޱO `8nOW7D*EoHt{O3dت8|d`<؛?FP;={q @2!mRqYM3i'3WxD͡k&UŽ =o#,ہj@0V0Ǎ>SHOLu 'JBE!ę̥ca e Ë8^9x^K6ʗpQ}mتZe?TO@!]1[IP*M ֑ 4H7f`֖zĜې{H++ضWIw^yK<#]{iuS+C>{C_/& C,D+/_K[1{*_ D^gjPG{\)\ Bs/ ^ lCwm6f4s>}JEZPTG)jg @?űO[aM"{/}l /bUQ3x)cS$@ٿ#al'veLR?z"&oj~XF{wPq<]j1s,^ߏ^|n^Ǒ؁L@, !9U;-.H?/ъE|'WC YrN莉)_UCPLp>?6UN|b % g2.S{'P'Xֺјi]/:roH0Aq'NsW !fݨ}2Nb´$mg\ky^C{fն|?SF/[fv/ݠaM\gQQ0O}mvxxᠶJҼF-)8z ܖZsy> ]aY'.}? :ڬ>ۯp-D"3"sۼ1J[ر6 yǘ3Uwm>Q_Lil>S6#6G#_z{A1D Ǥ˔7zO DISB<;e7}hNu%s+:p 5KvdT")Oo*>,智sj w zHIpK떀̧I -8I^A5siJƱ M/,"#zI.,!:P([.bJ!Z>o[84zF/k$2]116S?.mI;9+y_shiʹ/|emڻbKd4'8\/Qz},'oenfs$ ooڅ@E>(#WB>{$+/ظtl7jb yvdA13 } GM/BfG&(45Zk$g3 |+> P>?:@3 ՗ Yt CX T8)#$Dm~˶!.ԕ lmxd8̝e;e'xpPHD_U@w qn/\RY)fŜN ?vld-VtAw) I"y>y˃wκ: 1F*M:^.hhKW_6)7t"II#oCp+/+%U[*%hy!:D(ar}Q~2+̔'F2ʷgk~ voHBFdt.xQX*h  N8F4 %^mٔ9S0TY^]ʙL ՟e;uʽr#YFdʈ2 AI{ 5^¤!VG)[¤cJכUX,jjDxiAV^#)fxo[Vx`1 Pn$0kf&y\(cB a! tA, 9*EqC'KHx~mg?2fڇeVJ6[\pH7 [O |}=.6R1_J4T]AH(E{،7X*)/<7b?"jSB+w0FH@#a&,^DE܍GL@OA(Ǐ.ӄ%>\$[q%d' rC\ 3`c=B[K`nq&pU_nIh؆ڛQ\xn1W?aS\kr(4U_%'X#`+\DmƘ 3$,Z4qNW)vo4;Ǹ%lůeFKngbmU]{!iKWvگ.RH% Υ*W/UEG[m"ޛ,CUBbmFCSbQt0PX}F)3oЄ _8JhN.0*639nbi+yui M+jvPU#"%sj9>b>aWm3&a"F:\4QP+VW2܏#Bit3WYhRJݾKR3h<ZG祦)C *ld{P)7F1ohhjZk3r4LhTkЇbWa:߉}2~vTY 9z\_LHY~y}»~68 HgFM2[=.z0ݺR]SE!qG2JiǢ'7QY9?hˏ;>8Ԫp/ 2^f2#4X'p۹NFV%gs"üVDWhyu|utgQK*!ҨGp9 D;qYȤRR@"ӽ ƿ W5YCq~fpdS=h*1~/imU9yŀޏ8{1[s3kp+2knxnl,7撲Ul3)\87-NcI|nNXu?|{FǦpTM޿:PV6"WY@H@\!xZ{\*f̠֕#[;/ў/*7x(T&%4EM ʧ,zp6Wt3 ~-}+PnmZfJ=m2-8bɑ@jêC":ڭǦw& ģ9iRU㗞{.?Ll .y"zf Ak]roZn8mybYo])xksg -׿ Ŀ Z2Rˋ@[Q~WOn@ʾ'uGo3+i\[Xo#~LИOeI:+8Ό 3h t^aAg1"ZsJ~+X}d)q>B)z.Mf ?d5 L~/&ķ1<<{}kW,1Rpɸ6z_=Ef~Ҍ[D9:vC7B "IƚǻT?K#'mvXi;/#N$@ɬS]iHgm 4G5ˊ9f3ZmƐ;e'TTh$+2{CaCkk\jߌh'Hxg)L rNwyDp>}p BFY-*Kd&y<P-cȜN5|G _3R?"#):QS\5>E>m5y#)p`]OV@:),>ܸ ќ\3 KRHL]G>; ZNq=fZ|>Z6HsbRq$~LBo@qW-ZDS{**ڪ+E>Cq5mm,Ec6&a@|IGfI9B ԪfnQ#6 V6 L6V2v;o]7V(|CiDG !1H&u沙jH\׬O*5FN.oc9?U3tX5bAUhQ$kqAWv;Cט |2?o þ R4HsSn *뷷0 ~~JTeqI+$?*}=n$r X03mhl ~&8㒙|~)+Щ7̃9)82Gj,0R^Lv0r=4}Es7+|育>h742Y  o1ǃ9RD36qD= UmwD-p!ϛ70ZqΕM}iʎXb&:@gE̍\=A?wѳN~w=RE" Z0DXlZ\jkT%VNg 1 oLi7^F rbMjZ@%dzypQ!;[꼊_fՇMG?d(QɉYss.8!+ȟY;x<W}-JUݏLD◕b?cYd@5CbGEV M @(Qy_OcZ6@#J3" 1CMr%kye*FkOsoTcȳ'vZ6 ONh/ϟd_zl'cg K9Lxߗt8q78;0%WgcKN RB7M-0h*^ʝLic:4knVHE][Da]13cevQ ', M%^ 4~Uy=J?}v: Q#>:d㏓\ze<+D=>` Oܦvg$ꕡh7@3wKN]f$#T44斄I̫\08fk[]qT"JjvoaKWv|QEj/j`/MW_t\j[OdQOVe]C.T2~OISl3st|NAT.CEm qg60y:Nsd}ԱLa*T_\r h%HI עny̮1"ն =Lj$>0 YZ07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!3Tϣp{1^e~! #fs YZ